1DKR - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURES OF BACILLUS SUBTILIS PHOSPHORIBOSYLPYROPHOSPHATE SYNTHETASE: MOLECULAR BASIS OF ALLOSTERIC INHIBITION AND ACTIVATION.

Authors :   T. A. Eriksen, A. Kadziola, A. -K. Bentsen, K. W. Harlow, S. Larsen

Date :   08 Dec 99 (Deposition) - 05 Apr 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (3x)

Keywords :   Domain Duplication, Open Alpha Beta Domain Structure, Phosphoribosyltransferase Type I Fold. , Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. A. Eriksen, A. Kadziola, A. K. Bentsen, K. W. Harlow, S. Larsen
Structural Basis For The Function Of Bacillus Subtilis Phosphoribosyl-Pyrophosphate Synthetase.
Nat. Struct. Biol. V. 7 303 2000
PubMed-ID: 10742175 | Reference-DOI: 10.1038/74069
(for further references see the PDB file header)

Molecule 1 - PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
	Chains	:	A, B
	EC Number	:	2.7.6.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PAB600
	Expression System Strain	:	HO773, IV
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423
	Synonym	:	RIBOSE-PHOSPHATE PYROPHOSPHOKINASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (3x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 12)

No.	Name	Count	Type	Full Name
1	SO4	12	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:227 , THR B:228 , ALA B:229 , GLY B:230 , THR B:231 , HOH B:1058 , HOH B:1060 , HOH B:1091 , HOH B:1099	BINDING SITE FOR RESIDUE SO4 B 1001
2	AC2	SOFTWARE	ASP A:227 , THR A:228 , ALA A:229 , GLY A:230 , THR A:231 , HOH A:1058 , HOH A:1080 , HOH A:1108	BINDING SITE FOR RESIDUE SO4 A 1002
3	AC3	SOFTWARE	ARG A:109 , SER B:52 , ARG B:54 , SER B:310 , VAL B:311 , SER B:312 , HOH B:1029	BINDING SITE FOR RESIDUE SO4 B 1003
4	AC4	SOFTWARE	SER A:52 , ARG A:54 , SER A:310 , VAL A:311 , SER A:312 , HOH A:1048 , HOH A:1112 , ARG B:109	BINDING SITE FOR RESIDUE SO4 A 1004

(no "SS Bond" information available for 1DKR)

Asymmetric Unit

No.	Residues
1	Asp A:66	-	Pro A:67
2	Asp B:66	-	Pro B:67

(no "SAP(SNP)/Variant" information available for 1DKR)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PRPP_SYNTHASE	PS00114	Phosphoribosyl pyrophosphate synthase signature.	KPRS_BACSU	134-149	2	A:133-148 B:133-148

Biological Unit 1 (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PRPP_SYNTHASE	PS00114	Phosphoribosyl pyrophosphate synthase signature.	KPRS_BACSU	134-149	6	A:133-148 B:133-148

(no "Exon" information available for 1DKR)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:298
 aligned with KPRS_BACSU | P14193 from UniProtKB/Swiss-Prot  Length:317

    Alignment length:309
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308         
           KPRS_BACSU     9 NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS 317
               SCOP domains d1dkra1 A:8-166 Phosphoribosylpyrophosphate synthetase                                                                                                         d1dkra2 A:167-316 Phosphoribosyl         pyrophosphate synthetase                                                                                      SCOP domains
               CATH domains 1dkrA02 A:8-151,A:293-313  [code=3.40.50.2020, no name defined]                                                                                 1dkrA01 A:152-292  [code=3.40.50.2020, no name          defined]                                                                             1dkrA02              --- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhh.....eeeee.....eeeee.......eeeee.....hhhhhhhhhhhhhhhhhhh...eeeeee...........--....hhhhhhhhhhhhhh..eeeee...hhhhhhhh...eeee.hhhhhhhhhhhh....eeeee....hhhhhhhhhhhhh..eeeee..---------.eee......eeeee..ee..hhhhhhhhhhhhh....eeeee..ee....hhhhhhhh..eeeeeee.............eeee.hhhhhhhhhhhhhhh..hhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------PRPP_SYNTHASE   ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1dkr A   8 NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRK--SREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKR---------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS 316
                                    17        27        37        47        57        67        77        87        97       | -|      117       127       137       147       157       167       177       187       197|        -|      217       227       237       247       257       267       277       287       297       307         
                                                                                                                           105  |                                                                                       198       208                                                                                                            
                                                                                                                              108

Chain B from PDB  Type:PROTEIN  Length:306
 aligned with KPRS_BACSU | P14193 from UniProtKB/Swiss-Prot  Length:317

    Alignment length:315
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     
           KPRS_BACSU     2 SNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLF 316
               SCOP domains d1dkrb1 B:1-166 Phosphoribosylpyrophosphate synthetase                                                                                                                d1dkrb2 B:167-315 Phosphoribosyl         pyrophosphate synthetase                                                                                     SCOP domains
               CATH domains -------1dkrB02 B:8-151,B:293-313  [code=3.40.50.2020, no name defined]                                                                                 1dkrB01 B:152-292  [code=3.40.50.2020, no name          defined]                                                                             1dkrB02              -- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee...hhhhhhhhhhhhh.....eeeee.....eeeee.......eeeee.....hhhhhhhhhhhhhhhhhhh...eeeeee.................hhhhhhhhhhhhhh..eeeee...hhhhhhhh...eeee.hhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhh...eeeee..---------.eee......eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee....hhhhhhhh....eeeee.............eeee.hhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------PRPP_SYNTHASE   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1dkr B   1 SNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKR---------MNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLF 315
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       | -       210       220       230       240       250       260       270       280       290       300       310     
                                                                                                                                                                                                                               198       208

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PRTase-like (145)

Superfamily: PRTase-like (145)

Family: Phosphoribosylpyrophosphate synthetase-like (6)

Protein domain: Phosphoribosylpyrophosphate synthetase (5)

Bacillus subtilis [TaxId: 1423] (3)

1a	d1dkra1	A:8-166
1b	d1dkra2	A:167-316
1c	d1dkrb1	B:1-166
1d	d1dkrb2	B:167-315

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2020, no name defined] (117)

Bacillus subtilis. Organism_taxid: 1423. (2)

1a	1dkrB02	B:8-151,B:293-313
1b	1dkrA02	A:8-151,A:293-313
1c	1dkrA01	A:152-292
1d	1dkrB01	B:152-292

(no "Pfam Domain" information available for 1DKR)

Asymmetric Unit(hide GO term definitions)

Chain A,B (KPRS_BACSU | P14193)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0004749	ribose phosphate diphosphokinase activity	Catalysis of the reaction: D-ribose 5-phosphate + ATP = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + 2 H(+).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006015	5-phosphoribose 1-diphosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of 5-phosphoribose 1-diphosphate, also known as 5-phosphoribosyl-1-pyrophosphate.
	GO:0044249	cellular biosynthetic process	The chemical reactions and pathways resulting in the formation of substances, carried out by individual cells.
	GO:0009165	nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of nucleotides, any nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the glycose moiety; may be mono-, di- or triphosphate; this definition includes cyclic-nucleotides (nucleoside cyclic phosphates).
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0009156	ribonucleoside monophosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of a ribonucleoside monophosphate, a compound consisting of a nucleobase linked to a ribose sugar esterified with phosphate on the sugar.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asp A:66 - Pro A:67	[ RasMol ]
		Asp B:66 - Pro B:67	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1dkr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KPRS_BACSU \| P14193
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.6.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KPRS_BACSU \| P14193
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	KPRS_BACSU \| P14193	:	1dku 1ibs

1dku	MADP MOLECULES BOUND AT ACTIVE SITE AND REGULATORY SITE

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File