|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1DKC) |
Sites (0, 0)| (no "Site" information available for 1DKC) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1DKC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DKC) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1DKC) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:38 aligned with PAFP_PHYAM | P81418 from UniProtKB/Swiss-Prot Length:65 Alignment length:38 37 47 57 PAFP_PHYAM 28 AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR 65 SCOP domains d1dkca_ A: Antifungal peptide PAFP-S SCOP domains CATH domains -------------------------------------- CATH domains Pfam domains -------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------- SAPs(SNPs) PROSITE --PLANT_C6_AMP PDB: A:3-35 --- PROSITE Transcript -------------------------------------- Transcript 1dkc A 1 AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR 38 10 20 30
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1DKC) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DKC) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (PAFP_PHYAM | P81418)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|