|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1DCM) |
Cis Peptide Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1DCM) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1DCM) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with FIXJ_RHIME | P10958 from UniProtKB/Swiss-Prot Length:204 Alignment length:121 12 22 32 42 52 62 72 82 92 102 112 122 FIXJ_RHIME 3 DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV 123 SCOP domains d1dcma_ A: Transcriptional regulatory protein FixJ, receiver domain SCOP domains CATH domains 1dcmA00 A:3-123 [code=3.40.50.2300, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --RESPONSE_REGULATORY PDB: A:5-119 UniProt: 5-119 ---- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1dcm A 3 DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV 123 12 22 32 42 52 62 72 82 92 102 112 122 Chain B from PDB Type:PROTEIN Length:121 aligned with FIXJ_RHIME | P10958 from UniProtKB/Swiss-Prot Length:204 Alignment length:121 12 22 32 42 52 62 72 82 92 102 112 122 FIXJ_RHIME 3 DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV 123 SCOP domains d1dcmb_ B: Transcriptional regulatory protein FixJ, receiver domain SCOP domains CATH domains 1dcmB00 B:3-123 [code=3.40.50.2300, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --RESPONSE_REGULATORY PDB: B:5-119 UniProt: 5-119 ---- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1dcm B 3 DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV 123 12 22 32 42 52 62 72 82 92 102 112 122
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1DCM) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (FIXJ_RHIME | P10958)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|