|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (1, 2) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1D2S) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (4, 4)
Asymmetric Unit (4, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:170 aligned with SHBG_HUMAN | P04278 from UniProtKB/Swiss-Prot Length:402 Alignment length:176 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 SHBG_HUMAN 42 PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC 217 SCOP domains d1d2sa_ A: Sex hormone-binding globulin SCOP domains CATH domains 1d2sA00 A:13-188 [code=2.60.120.200, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------L-------------------------------- SAPs(SNPs) PROSITE ---LAM_G_DOMAIN PDB: A:16-188 UniProt: 45-217 PROSITE Transcript 1 (1) Exon 1.3 PDB: A:13-39 ---------------------------------------------------------------Exon 1.5 PDB: A:103-156 (gaps) UniProt: 132-185 Exon 1.6 PDB: A:157-188 Transcript 1 (1) Transcript 1 (2) --------------------------Exon 1.4 PDB: A:39-102 UniProt: 68-131 -------------------------------------------------------------------------------------- Transcript 1 (2) 1d2s A 13 PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSG------HPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC 188 22 32 42 52 62 72 82 92 102 112 122 | - | 142 152 162 172 182 129 136
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1D2S) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (SHBG_HUMAN | P04278)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|