Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CHYMOSIN COMPLEX WITH THE INHIBITOR CP-113972
 
Authors :  M. R. Groves, V. Dhanaraj, J. E. Pitts, M. Badasso, D. Hoover, P. Nugent, T. L. Blundell
Date :  15 Jan 97  (Deposition) - 01 Apr 97  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  E,P
Keywords :  Acid Proteinase, Aspartyl Protease, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. R. Groves, V. Dhanaraj, M. Badasso, P. Nugent, J. E. Pitts, D. J. Hoover, T. L. Blundell
A 2. 3 A Resolution Structure Of Chymosin Complexed With A Reduced Bond Inhibitor Shows That The Active Site Beta-Hairpin Flap Is Rearranged When Compared With The Native Crystal Structure.
Protein Eng. V. 11 833 1998
PubMed-ID: 9862200  |  Reference-DOI: 10.1093/PROTEIN/11.10.833
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHYMOSIN
    CellFUNDUS
    ChainsE
    EC Number3.4.23.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    OrganSTOMACH
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsCALF
    SynonymRENIN
 
Molecule 2 - CP-113972 (NORSTATINE-S-METHYL CYSTEINE-IODO-PHENYLALANINE- PROLINE)
    ChainsP
    EngineeredYES
    SynonymPFIZER INHIBITOR
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit EP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1NOR1Mod. Amino AcidCYCLOHEXYL-NORSTATINE
2PHI1Mod. Amino AcidIODO-PHENYLALANINE
3SMC1Mod. Amino AcidS-METHYLCYSTEINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1UNKNOWNASP E:32ACTIVE SITE.
2AC2UNKNOWNASP E:215ACTIVE SITE.
3AC3SOFTWARESER E:12 , GLN E:13 , ASP E:32 , GLY E:34 , TYR E:75 , GLY E:76 , THR E:77 , VAL E:111 , PHE E:112 , PHE E:117 , ILE E:120 , ILE E:213 , ASP E:215 , GLY E:217 , THR E:218 , SER E:219 , LYS E:220 , GLN E:287 , ILE E:300BINDING SITE FOR CHAIN P OF CP-113972 (NORSTATINE-S-METHYL CYSTEINE-IODO-PHENYLALANINE-

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1E:45 -E:50
2E:206 -E:210
3E:249 -E:282

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Thr E:22 -Pro E:23

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CHYM_BOVIN_001 *G302DCHYM_BOVIN  ---  ---EG243D
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.CHYM_BOVIN74-378  1E:14-323
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.CHYM_BOVIN89-100
271-282
  2E:29-40
E:212-223

(-) Exons   (8, 8)

Asymmetric/Biological Unit (8, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000139701ENSBTAE00000266971chr3:35631399-3563131387CHYM_BOVIN1-21210--
1.2ENSBTAT000000139702ENSBTAE00000266969chr3:35628381-35628231151CHYM_BOVIN21-71511E:-2-1113
1.3ENSBTAT000000139703ENSBTAE00000114008chr3:35627470-35627353118CHYM_BOVIN72-111401E:12-5140
1.4ENSBTAT000000139704ENSBTAE00000114011chr3:35626285-35626167119CHYM_BOVIN111-150401E:51-9040
1.5ENSBTAT000000139705ENSBTAE00000266967chr3:35624649-35624450200CHYM_BOVIN151-217671E:91-15767
1.6ENSBTAT000000139706ENSBTAE00000114017chr3:35623869-35623756114CHYM_BOVIN217-255391E:157-196 (gaps)40
1.7ENSBTAT000000139707ENSBTAE00000114020chr3:35622433-35622289145CHYM_BOVIN255-303491E:196-24449
1.8ENSBTAT000000139708ENSBTAE00000114021chr3:35621673-3562157599CHYM_BOVIN304-336331E:245-27733
1.9ENSBTAT000000139709ENSBTAE00000266965chr3:35620863-35620595269CHYM_BOVIN337-381451E:278-326 (gaps)49

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain E from PDB  Type:PROTEIN  Length:323
 aligned with CHYM_BOVIN | P00794 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:323
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378   
           CHYM_BOVIN    59 GEVASVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIHYGTGSMQGILGYDTVTVSNIVDIQQTVGLSTQEPGDVFTYAEFDGILGMAYPSLASEYSIPVFDNMMNRHLVAQDLFSVYMDRNGQESMLTLGAIDPSYYTGSLHWVPVTVQQYWQFTVDSVTISGVVVACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQGFCTSGFQSENHSQKWILGDVFIREYYSVFDRANNLVGLAKAI 381
               SCOP domains d1czie_ E: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains -1cziE01 E:-1-170 Acid Proteases                                                                                                                                           1cziE02 E:171-325 Acid Proteases                                                                                                                       - CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee...eeeeeeee....eeeeeeee......eee......hhhh......hhh.........eeeee....eeeeeeeee.eee..eee..eeeeeeee............eeee...hhh.......hhhhhhh.......eeeee.......eeeee....hhh.....eeee.......eeee.eeee..eeee....eeeee......eeeehhhhhhhhhhh................hhh...eeeee..eeeee.....eeee..eeee.eeee.....eee.hhhh..eeeeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------PEPTIDASE_A1  PDB: E:14-323 UniProt: 74-378                                                                                                                                                                                                                                                                      --- PROSITE (1)
                PROSITE (2) ------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2     Exon 1.3  PDB: E:12-51 UniProt: 72-111  ---------------------------------------Exon 1.5  PDB: E:91-157 UniProt: 151-217                           -------------------------------------Exon 1.7  PDB: E:196-244 UniProt: 255-303        Exon 1.8  PDB: E:245-277         Exon 1.9  PDB: E:278-326 (gaps)               Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: E:51-90 UniProt: 111-150 ------------------------------------------------------------------Exon 1.6  PDB: E:157-196 (gaps)        ------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1czi E  -2 GEVASVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIHYGTGSMQGILGYDTVTVSNIVDIQQTVGLSTQEPGDVFTYAEFDGILGMAYPSLASEYSIPVFDNMMNRHLVAQDLFSVYMDRNGQESMLTLGAIDPSYYTGSLHWVPVTVQQYWQFTVDSVTISGVVVACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQGFCTSGFQSENHSQKWILGDVFIREYYSVFDRANNLVGLAKAI 326
                             ||      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158||     169       179       189       199       209       219       229       239       249       259       269       279       289  ||   303       313       323   
                             ||                                                                                                                                                           159|                                                                                                                                292|                             
                            -1|                                                                                                                                                            161                                                                                                                                 297                             
                              1                                                                                                                                                                                                                                                                                                                                

Chain P from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1czi P   4 Pfcx   1
                            ||||
                            4|||
                             3-PHI
                              2-SMC
                               1-NOR

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CZI)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain E   (CHYM_BOVIN | P00794)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0030163    protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NOR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PHI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SMC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr E:22 - Pro E:23   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1czi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CHYM_BOVIN | P00794
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CHYM_BOVIN | P00794
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CHYM_BOVIN | P007941cms 3cms 4aa8 4auc 4cms

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CZI)