|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1CZ5) |
Sites (0, 0)| (no "Site" information available for 1CZ5) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1CZ5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1CZ5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1CZ5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1CZ5) |
Exons (0, 0)| (no "Exon" information available for 1CZ5) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:185 aligned with VAT_THEAC | O05209 from UniProtKB/Swiss-Prot Length:745 Alignment length:194 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 VAT_THEAC 1 MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEEVSRISYEDIGG 194 SCOP domains d1cz5a1 A:1-91 N-terminal domain of VAT-N, VAT-Nn d1cz5a2 A:92-185 C-terminal domain of VAT-N, VAT-Nc SCOP domains CATH domains 1cz5A01 A:1-92 [code=2.40.40.20, no name defined] 1cz5A02 A:93-173 [code=3.10.330.10, no name defined] --------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1cz5 A 1 MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASIGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKIEIREEPASEVLEE---------GG 185 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 | - | 183 184
|
||||||||||||||||||||
SCOP Domains (2, 2)
NMR Structure
|
CATH Domains (2, 2)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1CZ5) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A (VAT_THEAC | O05209)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|