|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1CYC) |
(no "Cis Peptide Bond" information available for 1CYC) |
(no "SAP(SNP)/Variant" information available for 1CYC) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1CYC) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with CYC_KATPE | P00025 from UniProtKB/Swiss-Prot Length:104 Alignment length:103 11 21 31 41 51 61 71 81 91 101 CYC_KATPE 2 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 104 SCOP domains d1cyca_ A: Mitochondrial cytochrome c SCOP domains CATH domains 1cycA00 A:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: A:1-102 UniProt: 2-103 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1cyc A 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:103 aligned with CYC_KATPE | P00025 from UniProtKB/Swiss-Prot Length:104 Alignment length:103 11 21 31 41 51 61 71 81 91 101 CYC_KATPE 2 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 104 SCOP domains d1cycb_ B: Mitochondrial cytochrome c SCOP domains CATH domains 1cycB00 B:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: B:1-102 UniProt: 2-103 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1cyc B 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1CYC) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC_KATPE | P00025)
|
|
|
|
|
|
|