|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1CXY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1CXY) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1CXY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:81 aligned with CYB5_ECTSH | P82291 from UniProtKB/Swiss-Prot Length:91 Alignment length:81 16 26 36 46 56 66 76 86 CYB5_ECTSH 7 TLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGTL 87 SCOP domains d1cxya_ A: Cytochrome b558 SCOP domains CATH domains 1cxyA00 A:6-86 Flavocytochrome B2, subunit A, domain 1 CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTOCHROME_B5_2 PDB: A:7-86 UniProt: 8-88 PROSITE Transcript --------------------------------------------------------------------------------- Transcript 1cxy A 6 TLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGTL 86 15 25 35 45 55 65 75 85
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1CXY) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (CYB5_ECTSH | P82291)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|