Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  ISOLATION, CRYSTALLIZATION, CRYSTAL STRUCTURE ANALYSIS AND REFINEMENT OF CONSTITUTIVE C-PHYCOCYANIN FROM THE CHROMATICALLY ADAPTING CYANOBACTERIUM FREMYELLA DIPLOSIPHON AT 1.66 ANGSTROMS RESOLUTION
 
Authors :  M. Duerring, G. B. Schmidt, R. Huber
Date :  11 Oct 90  (Deposition) - 15 Jan 93  (Release) - 10 Apr 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.66
Chains :  Asym. Unit :  A,B,K,L
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  K,L  (1x)
Biol. Unit 3:  A,B,K,L  (3x)
Biol. Unit 4:  A,B  (3x)
Biol. Unit 5:  K,L  (3x)
Biol. Unit 6:  A,B,K,L  (1x)
Keywords :  Light Harvesting Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Duerring, G. B. Schmidt, R. Huber
Isolation, Crystallization, Crystal Structure Analysis And Refinement Of Constitutive C-Phycocyanin From The Chromatically Adapting Cyanobacterium Fremyella Diplosiphon At 1. 66 A Resolution.
J. Mol. Biol. V. 217 577 1991
PubMed-ID: 1899708  |  Reference-DOI: 10.1016/0022-2836(91)90759-Y

(-) Compounds

Molecule 1 - C-PHYCOCYANIN (ALPHA SUBUNIT)
    Chains: A, K
    Engineered: YES
    Organism Scientific: FREMYELLA DIPLOSIPHON
    Organism Taxid: 1197
 
Molecule 2 - C-PHYCOCYANIN (BETA SUBUNIT)
    Chains: B, L
    Engineered: YES
    Organism Scientific: FREMYELLA DIPLOSIPHON
    Organism Taxid: 1197

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABKL
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   KL
Biological Unit 3 (3x): ABKL
Biological Unit 4 (3x): AB  
Biological Unit 5 (3x):   KL
Biological Unit 6 (1x): ABKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1CYC6Ligand/IonPHYCOCYANOBILIN
2MEN2Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1CYC3Ligand/IonPHYCOCYANOBILIN
2MEN1Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1CYC3Ligand/IonPHYCOCYANOBILIN
2MEN1Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 3 (2, 24)
No.NameCountTypeFull Name
1CYC18Ligand/IonPHYCOCYANOBILIN
2MEN6Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 4 (2, 12)
No.NameCountTypeFull Name
1CYC9Ligand/IonPHYCOCYANOBILIN
2MEN3Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 5 (2, 12)
No.NameCountTypeFull Name
1CYC9Ligand/IonPHYCOCYANOBILIN
2MEN3Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 6 (2, 8)
No.NameCountTypeFull Name
1CYC6Ligand/IonPHYCOCYANOBILIN
2MEN2Mod. Amino AcidN-METHYL ASPARAGINE

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:59 , PRO A:72 , ASN A:73 , PHE A:74 , ALA A:75 , GLY A:80 , LYS A:83 , CYS A:84 , ARG A:86 , ASP A:87 , TYR A:110 , TRP A:128 , HOH A:188 , HOH A:189 , HOH A:216 , HOH A:227 , ARG B:57 , ILE B:67 , THR B:77 , HOH B:202BINDING SITE FOR RESIDUE CYC A 175
2AC2unknownLEU B:122 , THR B:124NULL
3AC3SOFTWAREALA B:75 , ARG B:80 , ALA B:83 , CYS B:84 , ARG B:86 , ASP B:87 , ILE B:90 , ARG B:110 , LEU B:115 , LEU B:122 , SER B:128 , HOH B:213BINDING SITE FOR RESIDUE CYC B 176
4AC4SOFTWAREPHE A:28 , ASN B:35 , LYS B:36 , ASP B:39 , VAL B:40 , GLY B:145 , ASP B:146 , ILE B:150 , THR B:151 , ARG B:152 , GLY B:153 , CYS B:155 , HOH B:192 , HOH B:195 , HOH B:234 , GLN K:33 , ASN K:57 , ASP K:147 , VAL K:150 , HOH K:214BINDING SITE FOR RESIDUE CYC B 177
5AC5SOFTWAREVAL K:59 , THR K:66 , PRO K:72 , ASN K:73 , PHE K:74 , ALA K:75 , LYS K:83 , CYS K:84 , ARG K:86 , ASP K:87 , TYR K:110 , PHE K:122 , TRP K:128 , TYR K:129 , HOH K:187 , HOH K:198 , HOH K:199 , HOH K:221 , HOH K:224 , ARG L:57 , ILE L:67 , THR L:77BINDING SITE FOR RESIDUE CYC K 175
6AC6SOFTWARELEU L:66 , ARG L:80 , CYS L:84 , ARG L:86 , ASP L:87 , ILE L:90 , ARG L:110 , LEU L:115 , LEU L:122BINDING SITE FOR RESIDUE CYC L 176
7AC7SOFTWAREGLN A:33 , ASP A:147 , VAL A:150 , ASN L:35 , ASP L:39 , VAL L:40 , GLY L:145 , ASP L:146 , ILE L:150 , THR L:151 , ARG L:152 , GLY L:153 , CYS L:155 , HOH L:200 , HOH L:201 , HOH L:215BINDING SITE FOR RESIDUE CYC L 177

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CPC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CPC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CPC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1CPC)

(-) Exons   (0, 0)

(no "Exon" information available for 1CPC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:162
 aligned with PHCA1_MICDP | P07122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:162
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160  
          PHCA1_MICDP     1 MKTPLTEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYTTSQNGPNFASTQTGKDKCVRDIGYYLRMVTYCLVVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINALS 162
               SCOP domains d1cpca_ A: Phycocyanin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1cpcA00 A:1-174 Phycocyanins                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1cpc A   1 MKTPLTEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYTTSQNGPNFASTQTGKDKCVRDIGYYLRMVTYCLVVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINALS 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140|      162       172  
                                                                                                                                                                     140|    150|             
                                                                                                                                                                      143     161             

Chain B from PDB  Type:PROTEIN  Length:172
 aligned with PHCB1_MICDP | P07119 from UniProtKB/Swiss-Prot  Length:172

    Alignment length:172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  
          PHCB1_MICDP     1 MLDAFAKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQLIAPGGNAYTSRRMAACLRDMEIILRYVTYAIFAGDASVLDDRCLNGLKETYLALGTPGSSVAVGVQKMKDAALAIAGDTNGITRGDCASLMAEVASYFDKAASAVA 172
               SCOP domains d1cpcb_ B: Phycocyanin beta subunit                                                                                                                                          SCOP domains
               CATH domains 1cpcB00 B:1-174 Phycocyanins                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cpc B   1 MLDAFAKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQLIAPGGnAYTSRRMAACLRDMEIILRYVTYAIFAGDASVLDDRCLNGLKETYLALGTPGSSVAVGVQKMKDAALAIAGDTNGITRGDCASLMAEVASYFDKAASAVA 174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142       152       162       172  
                                                                                                  72-MEN                                                                                                
                                                                                                   75                                                                                                   

Chain K from PDB  Type:PROTEIN  Length:162
 aligned with PHCA1_MICDP | P07122 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:162
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160  
          PHCA1_MICDP     1 MKTPLTEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYTTSQNGPNFASTQTGKDKCVRDIGYYLRMVTYCLVVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINALS 162
               SCOP domains d1cpck_ K: Phycocyanin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1cpcK00 K:1-174 Phycocyanins                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................................................................................................................................................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1cpc K   1 MKTPLTEAVAAADSQGRFLSSTEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSKFPYTTSQNGPNFASTQTGKDKCVRDIGYYLRMVTYCLVVGGTGPLDDYLIGGIAEINRTFDLSPSWYVEALKYIKANHGLSGDPAVEANSYIDYAINALS 174
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140|      162       172  
                                                                                                                                                                     140|    150|             
                                                                                                                                                                      143     161             

Chain L from PDB  Type:PROTEIN  Length:172
 aligned with PHCB1_MICDP | P07119 from UniProtKB/Swiss-Prot  Length:172

    Alignment length:172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  
          PHCB1_MICDP     1 MLDAFAKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQLIAPGGNAYTSRRMAACLRDMEIILRYVTYAIFAGDASVLDDRCLNGLKETYLALGTPGSSVAVGVQKMKDAALAIAGDTNGITRGDCASLMAEVASYFDKAASAVA 172
               SCOP domains d1cpcl_ L: Phycocyanin beta subunit                                                                                                                                          SCOP domains
               CATH domains 1cpcL00 L:1-174 Phycocyanins                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............................................................................................................................................................................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cpc L   1 MLDAFAKVVSQADARGEYLSGSQIDALSALVADGNKRMDVVNRITGNSSTIVANAARSLFAEQPQLIAPGGnAYTSRRMAACLRDMEIILRYVTYAIFAGDASVLDDRCLNGLKETYLALGTPGSSVAVGVQKMKDAALAIAGDTNGITRGDCASLMAEVASYFDKAASAVA 174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142       152       162       172  
                                                                                                  72-MEN                                                                                                
                                                                                                   75                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CPC)

(-) Gene Ontology  (7, 14)

Asymmetric Unit(hide GO term definitions)
Chain A,K   (PHCA1_MICDP | P07122)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

Chain B,L   (PHCB1_MICDP | P07119)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
    GO:0042651    thylakoid membrane    The pigmented membrane of any thylakoid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CYC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cpc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Insightii
  protein: ribbon; ligands: spacefill mono, stereo)
Midas
  protein: ribbon, secondaryu structure; ligands: surface
Setor
  protein: ribbon, chain-specific coloring; ligands: spacefill
  spacefill; chain-specific coloring
  protein: chain, labeling; ligand: spacefill; detailed view
  protein: chain, labeling; ligand: spacefill; detailed view
Distance Plot
  representative atom: CA

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cpc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHCA1_MICDP | P07122
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHCB1_MICDP | P07119
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PHCA1_MICDP | P07122
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHCB1_MICDP | P07119
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1CPC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CPC)