1CPB - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURE OF CARBOXYPEPTIDASE B AT 2.8 ANGSTROMS RESOLUTION

Authors :   M. F. Schmid, J. R. Herriott

Date :   23 Jun 76 (Deposition) - 14 Nov 77 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Hydrolase (C-Terminal Peptidase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. F. Schmid, J. R. Herriott
Structure Of Carboxypeptidase B At 2-8 A Resolution.
J. Mol. Biol. V. 103 175 1976
PubMed-ID: 957425 | Reference-DOI: 10.1016/0022-2836(76)90058-9
(for further references see the PDB file header)

Molecule 1 - CARBOXYPEPTIDASE B
	Chains	:	A
	EC Number	:	3.4.17.2
	Engineered	:	YES
	Organ	:	PANCREAS
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

Molecule 2 - CARBOXYPEPTIDASE B
	Chains	:	B
	EC Number	:	3.4.17.2
	Engineered	:	YES
	Organ	:	PANCREAS
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1CPB)

(no "Site" information available for 1CPB)

(no "SS Bond" information available for 1CPB)

(no "Cis Peptide Bond" information available for 1CPB)

(no "SAP(SNP)/Variant" information available for 1CPB)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CARBOXYPEPT_ZN_1	PS00132	Zinc carboxypeptidases, zinc-binding region 1 signature.	CBPB1_BOVIN	167-189	1	A:60-82
2	CARBOXYPEPT_ZN_2	PS00133	Zinc carboxypeptidases, zinc-binding region 2 signature.	CBPB1_BOVIN	304-314	1	B:196-206

Asymmetric/Biological Unit (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000000580	1	ENSBTAE00000004449	chr1:121325659-121325578	82	CBPB1_BOVIN	1-24	24	0	-	-
1.2	ENSBTAT00000000580	2	ENSBTAE00000004450	chr1:121325468-121325393	76	CBPB1_BOVIN	24-49	26	0	-	-
1.3	ENSBTAT00000000580	3	ENSBTAE00000004451	chr1:121316045-121315921	125	CBPB1_BOVIN	50-91	42	0	-	-
1.4	ENSBTAT00000000580	4	ENSBTAE00000004452	chr1:121309412-121309313	100	CBPB1_BOVIN	91-124	34	1	A:4-17 -	14 -
1.5	ENSBTAT00000000580	5	ENSBTAE00000004453	chr1:121309224-121309123	102	CBPB1_BOVIN	125-158	34	1	A:18-51 -	34 -
1.6	ENSBTAT00000000580	6	ENSBTAE00000004456	chr1:121308278-121308177	102	CBPB1_BOVIN	159-192	34	1	A:52-85 -	34 -
1.7	ENSBTAT00000000580	7	ENSBTAE00000242261	chr1:121305532-121305422	111	CBPB1_BOVIN	193-229	37	1	- B:93-122	- 30
1.8	ENSBTAT00000000580	8	ENSBTAE00000004462	chr1:121305335-121305245	91	CBPB1_BOVIN	230-260	31	1	- B:123-153	- 31
1.9	ENSBTAT00000000580	9	ENSBTAE00000004465	chr1:121304069-121303867	203	CBPB1_BOVIN	260-327	68	1	- B:153-219	- 68
1.10	ENSBTAT00000000580	10	ENSBTAE00000004468	chr1:121290828-121290744	85	CBPB1_BOVIN	328-356	29	1	- B:220-248	- 29
1.11	ENSBTAT00000000580	11	ENSBTAE00000004470	chr1:121289018-121288650	369	CBPB1_BOVIN	356-417	62	1	- B:248-308	- 61

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:82
 aligned with CBPB1_BOVIN | P00732 from UniProtKB/Swiss-Prot  Length:417

    Alignment length:82
                                   120       130       140       150       160       170       180       190  
         CBPB1_BOVIN    111 TTGHSYEKYNNWETIEAWTEQVASENPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREWISPAFCQWFVRE  192
               SCOP domains d1cpb.1 A:,B: Carboxypeptidase B                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh.....eeee............eeeeee......eeeeeeee....hhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------CARBOXYPEPT_ZN_1       --- PROSITE
           Transcript 1 (1) Exon 1.4      Exon 1.5  PDB: A:18-51            Exon 1.6  PDB: A:52-85             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------- Transcript 1 (2)
                1cpb A    4 TTGHSYEKYNNWETIEAWTEQVASENPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREWISPAFCQWFVRE   85
                                    13        23        33        43        53        63        73        83

Chain B from PDB  Type:PROTEIN  Length:217
 aligned with CBPB1_BOVIN | P00732 from UniProtKB/Swiss-Prot  Length:417

    Alignment length:217
                                   209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       
         CBPB1_BOVIN    200 EIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTRAGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAYLTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYTYGPGASTIYPASGGSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHL  416
               SCOP domains d1cpb.1 A:,B: Carboxypeptidase B                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) .hhhhhhhh..eeeee...hhhhhhhh.....................................................hhhhhhhhhhhhhhh...eeeeeee...eeeee...........hhhhhhhhhhhhhhhhhh.....eee............hhhhhhhhhhhhh-----.............hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author (1)
     Sec.struct. author (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------eeeeeee------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------CARBOXYPEPT------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.7  PDB: B:93-122       Exon 1.8  PDB: B:123-153       -------------------------------------------------------------------Exon 1.10  PDB: B:220-248    ------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.9  PDB: B:153-219 UniProt: 260-327                           ----------------------------Exon 1.11  PDB: B:248-308 UniProt: 356-417 [INCOMPLETE]       Transcript 1 (2)
                1cpb B   93 EIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTRAGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAYLTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYSYGPGATTIYPASGGSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHL  308
                                   102       112       122       132       142       152       162       172       182      |191       201       211       221       231       241       251       261       271       281       291       301       
                                                                                                                         188A

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Phosphorylase/hydrolase-like (558)

Superfamily: Zn-dependent exopeptidases (214)

Family: Pancreatic carboxypeptidases (77)

Protein domain: Carboxypeptidase B (10)

Cow (Bos taurus) [TaxId: 9913] (1)

d1cpb.1

A:,B:

(no "CATH Domain" information available for 1CPB)

(no "Pfam Domain" information available for 1CPB)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CBPB1_BOVIN | P00732)

molecular function
	GO:0004180	carboxypeptidase activity	Catalysis of the hydrolysis of the terminal or penultimate peptide bond at the C-terminal end of a peptide or polypeptide.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004181	metallocarboxypeptidase activity	Catalysis of the hydrolysis of C-terminal amino acid residues from a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008237	metallopeptidase activity	Catalysis of the hydrolysis of peptide bonds by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cpb)

	Sites
(no "Sites" information available for 1cpb)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cpb)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1cpb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CBPB1_BOVIN \| P00732
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.17.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CBPB1_BOVIN \| P00732
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1CPB)

(no "Related Entries Specified in the PDB File" available for 1CPB)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File