Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CONCANAVALIN B AT 1.65 A RESOLUTION
 
Authors :  M. Hennig
Date :  20 Feb 95  (Deposition) - 08 Mar 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A
Keywords :  Plant Chitinase, Chitin Binding Protein, Seed Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Hennig, J. N. Jansonius, A. C. Terwisscha Van Scheltinga, B. W. Dijkstra, B. Schlesier
Crystal Structure Of Concanavalin B At 1. 65 A Resolution. An "Inactivated" Chitinase From Seeds Of Canavalia Ensiformis.
J. Mol. Biol. V. 254 237 1995
PubMed-ID: 7490746  |  Reference-DOI: 10.1006/JMBI.1995.0614
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CONCANAVALIN B
    Chains: A
    Organ: SEED
    Organism Common: JACK BEAN
    Organism Scientific: CANAVALIA ENSIFORMIS
    Organism Taxid: 3823
    Tissue: SEED

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CNV)

(-) Sites  (0, 0)

(no "Site" information available for 1CNV)

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:23 -A:72
2A:41 -A:93
3A:54 -A:62
4A:165 -A:194

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:34 -Phe A:35
2Ser A:167 -Pro A:168
3Tyr A:216 -Pro A:217
4Trp A:265 -Asn A:266

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CNV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1CNV)

(-) Exons   (0, 0)

(no "Exon" information available for 1CNV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:283
 aligned with CONB_CANEN | P49347 from UniProtKB/Swiss-Prot  Length:324

    Alignment length:283
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305   
           CONB_CANEN    26 DISSTEIAVYWGQREDGLLRDTCKTNNYKIVFISFLDKFGCEIRKPELELEGVCGPSVGNPCSFLESQIKECQRMGVKVFLALGGPKGTYSACSADYAKDLAEYLHTYFLSERREGPLGKVALDGIHFDIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCLSPDEYLDNAIQTRHFDYIFVRFYNDRSCQYSTGNIQRIRNAWLSWTKSVYPRDKNLFLELPASQATAPGGGYIPPSALIGQVLPYLPDLQTRYAGIALWNRQADKETGYSTNIIRYL 308
               SCOP domains d1cnva_ A: Seed storage protein                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1cnvA00 A:1-283 Glycosidases                                                                                                                                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhh.eeeeee..hhh..hhhhhhh....eeee............................hhhhhhhhhhhhh...eeeeeee..........hhhhhhhhhhhhhhh...............eeeee.........hhhhhhhhhhhhhh.....eeee...........hhhhhh.....eeee..............hhhhhhhhhhhhh.......eeeeee..hhh........hhhhhhh.hhh...hhhheeeeeee.hhhhhhh.hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cnv A   1 DISSTEIAVYWGQREDGLLRDTCKTNNYKIVFISFLDKFGCEIRKPELELEGVCGPSVGNPCSFLESQIKECQRMGVKVFLALGGPKGTYSACSADYAKDLAEYLHTYFLSERREGPLGKVALDGIHFDIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCLSPDEYLDNAIQTRHFDYIFVRFYNDRSCQYSTGNIQRIRNAWLSWTKSVYPRDKNLFLELPASQATAPGGGYIPPSALIGQVLPYLPDLQTRYAGIALWNRQADKETGYSTNIIRYL 283
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CNV)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CONB_CANEN | P49347)
molecular function
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cnv)
 
  Sites
(no "Sites" information available for 1cnv)
 
  Cis Peptide Bonds
    Ser A:167 - Pro A:168   [ RasMol ]  
    Ser A:34 - Phe A:35   [ RasMol ]  
    Trp A:265 - Asn A:266   [ RasMol ]  
    Tyr A:216 - Pro A:217   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cnv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CONB_CANEN | P49347
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CONB_CANEN | P49347
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1CNV)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CNV)