1CMS - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   THE THREE-DIMENSIONAL STRUCTURE OF RECOMBINANT BOVINE CHYMOSIN AT 2.3 ANGSTROMS RESOLUTION

Authors :   G. L. Gilliland, E. L. Winborne, J. Nachman, A. Wlodawer

Date :   12 Oct 89 (Deposition) - 15 Jan 90 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A

Keywords :   Hydrolase(Acid Proteinase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. L. Gilliland, E. L. Winborne, J. Nachman, A. Wlodawer
The Three-Dimensional Structure Of Recombinant Bovine Chymosin At 2. 3 A Resolution.
Proteins V. 8 82 1990
PubMed-ID: 2217166 | Reference-DOI: 10.1002/PROT.340080110
(for further references see the PDB file header)

Molecule 1 - PROCHYMOSIN A/B PRECURSOR
	Chains	:	A
	EC Number	:	3.4.23.4
	Engineered	:	YES
	Organism Common	:	CATTLE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1CMS)

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	AUTHOR	ASP A:34	ACTIVE SITE ASPARTATE1
2	AC2	AUTHOR	ASP A:216	ACTIVE SITE ASPARTATE2

Asymmetric/Biological Unit

No.	Residues
1	A:47	-	A:52
2	A:207	-	A:211
3	A:250	-	A:283

Asymmetric/Biological Unit

No.	Residues
1	Thr A:24	-	Pro A:25

Asymmetric/Biological Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CHYM_BOVIN_001 *	G	302	D	CHYM_BOVIN	---	---	A	G	244	D
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PEPTIDASE_A1	PS51767	Peptidase family A1 domain profile.	CHYM_BOVIN	74-378	1	A:16-320
2	ASP_PROTEASE	PS00141	Eukaryotic and viral aspartyl proteases active site.	CHYM_BOVIN	89-100 271-282	2	A:31-42 A:213-224

Asymmetric/Biological Unit (8, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000013970	1	ENSBTAE00000266971	chr3:35631399-35631313	87	CHYM_BOVIN	1-21	21	0	-	-
1.2	ENSBTAT00000013970	2	ENSBTAE00000266969	chr3:35628381-35628231	151	CHYM_BOVIN	21-71	51	1	A:1-13	13
1.3	ENSBTAT00000013970	3	ENSBTAE00000114008	chr3:35627470-35627353	118	CHYM_BOVIN	72-111	40	1	A:14-53	40
1.4	ENSBTAT00000013970	4	ENSBTAE00000114011	chr3:35626285-35626167	119	CHYM_BOVIN	111-150	40	1	A:53-92	40
1.5	ENSBTAT00000013970	5	ENSBTAE00000266967	chr3:35624649-35624450	200	CHYM_BOVIN	151-217	67	1	A:93-159	67
1.6	ENSBTAT00000013970	6	ENSBTAE00000114017	chr3:35623869-35623756	114	CHYM_BOVIN	217-255	39	1	A:159-197	39
1.7	ENSBTAT00000013970	7	ENSBTAE00000114020	chr3:35622433-35622289	145	CHYM_BOVIN	255-303	49	1	A:197-245	49
1.8	ENSBTAT00000013970	8	ENSBTAE00000114021	chr3:35621673-35621575	99	CHYM_BOVIN	304-336	33	1	A:246-278	33
1.9	ENSBTAT00000013970	9	ENSBTAE00000266965	chr3:35620863-35620595	269	CHYM_BOVIN	337-381	45	1	A:279-323	45

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with CHYM_BOVIN | P00794 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:323
                                    68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378   
           CHYM_BOVIN    59 GEVASVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIHYGTGSMQGILGYDTVTVSNIVDIQQTVGLSTQEPGDVFTYAEFDGILGMAYPSLASEYSIPVFDNMMNRHLVAQDLFSVYMDRNGQESMLTLGAIDPSYYTGSLHWVPVTVQQYWQFTVDSVTISGVVVACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQGFCTSGFQSENHSQKWILGDVFIREYYSVFDRANNLVGLAKAI 381
               SCOP domains d1cmsa_ A: Chymosin (synonym: renin)                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains --1cmsA01 A:3-171 Acid Proteases                                                                                                                                           1cmsA02 A:172-323 Acid Proteases                                                                                                                         CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ...eeee.eee...eeeeeeee....eeeeeeee....eeee......hhhhhh................eeeeeee..eeeeeee...eeee..eee....eeeeee...hhhhh....eeeee............hhhhhhh.......eeeee........eeee.......eeeeeeeee......eeeeeeeee...eeee....eeeee.....eeee.hhhhhhhhhhh.eeee...eeee..........eeeee..eeeeehhhhh----..eeeeeeeee.....eeeehhhhhheeeeee....eeeeeee. Sec.struct. author (1)
     Sec.struct. author (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------eeeee-------------------------------------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---------------PEPTIDASE_A1  PDB: A:16-320 UniProt: 74-378                                                                                                                                                                                                                                                                      --- PROSITE (1)
                PROSITE (2) ------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE--------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2     Exon 1.3  PDB: A:14-53 UniProt: 72-111  ---------------------------------------Exon 1.5  PDB: A:93-159 UniProt: 151-217                           -------------------------------------Exon 1.7  PDB: A:197-245 UniProt: 255-303        Exon 1.8  PDB: A:246-278         Exon 1.9  PDB: A:279-323 UniProt: 337-381     Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: A:53-92 UniProt: 111-150 ------------------------------------------------------------------Exon 1.6  PDB: A:159-197               ------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 1cms A   1 GEVASVPLTNYLDSQYFGKIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSNACKNHQRFDPRKSSTFQNLGKPLSIHYGTGSMQGILGYDTVTVSNIVDIQQTVGLSTQEPGDVFTYAEFDGILGMAYPSLASEYSIPVFDNMMNRHLVAQDLFSVYMDRNGQESMLTLGAIDPSYYTGSLHWVPVTVQQYWQFTVDSVTISGVVVACEGGCQAILDTGTSKLVGPSSDILNIQQAIGATQNQYGEFDIDCDNLSYMPTVVFEINGKMYPLTPSAYTSQDQGFCTSGFQSENHSQKWILGDVFIREYYSVFDRANNLVGLAKAI 323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Acid proteases (1120)

Superfamily: Acid proteases (1120)

Family: Pepsin-like (505)

Protein domain: Chymosin (synonym: renin) (67)

Cow (Bos taurus) [TaxId: 9913] (6)

d1cmsa_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Cathepsin D, subunit A; domain 1 (745)

Homologous Superfamily: Acid Proteases (745)

Cattle (Bos taurus) (4)

1a	1cmsA02	A:172-323
1b	1cmsA01	A:3-171

(no "Pfam Domain" information available for 1CMS)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (CHYM_BOVIN | P00794)

molecular function
	GO:0004190	aspartic-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0030163	protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cms)

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr A:24 - Pro A:25	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1cms
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CHYM_BOVIN \| P00794
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.23.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CHYM_BOVIN \| P00794
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CHYM_BOVIN \| P00794	:	1czi 3cms 4aa8 4auc 4cms

(no "Related Entries Specified in the PDB File" available for 1CMS)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (2, 2)

SS Bonds (3, 3)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (2, 3)

Exons (8, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File