1CLF - JenaLib

NMR Structure - model 1

NMR Structure - model 1, sites

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - model 1, sites (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   CLOSTRIDIUM PASTEURIANUM FERREDOXIN

Authors :   I. Bertini, A. Donaire, B. A. Feinberg, C. Luchinat, M. Piccioli, H. Yuan

Date :   21 Jun 95 (Deposition) - 29 Jan 96 (Release) - 24 Mar 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (16x)

Keywords :   Electron Transfer (Iron-Sulfur Protein) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   I. Bertini, A. Donaire, B. A. Feinberg, C. Luchinat, M. Piccioli, H. Yuan
Solution Structure Of The Oxidized 2[4Fe-4S] Ferredoxin From Clostridium Pasteurianum.
Eur. J. Biochem. V. 232 192 1995
PubMed-ID: 7556151 | Reference-DOI: 10.1111/J.1432-1033.1995.TB20799.X
(for further references see the PDB file header)

Compounds

Molecule 1 - FERREDOXIN
	Atcc	:	6013
	Chains	:	A
	Organism Scientific	:	CLOSTRIDIUM PASTEURIANUM
	Organism Taxid	:	1501
	Strain	:	WINOGRADSKY

Structural Features

Chains, Units


NMR Structure (16x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (1, 2)

NMR Structure (1, 2)

No.	Name	Count	Type	Full Name
1	SF4	2	Ligand/Ion	IRON/SULFUR CLUSTER

Sites (2, 2)

NMR Structure (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:4 , CYS A:8 , VAL A:9 , CYS A:11 , GLY A:12 , ALA A:13 , CYS A:14 , PHE A:30 , CYS A:47	BINDING SITE FOR RESIDUE SF4 A 56
2	AC2	SOFTWARE	CYS A:18 , PRO A:19 , VAL A:20 , CYS A:37 , ILE A:38 , CYS A:40 , ASN A:42 , CYS A:43	BINDING SITE FOR RESIDUE SF4 A 57

SS Bonds (0, 0)

(no "SS Bond" information available for 1CLF)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1CLF)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 1CLF)

PROSITE Motifs (2, 3)

NMR Structure (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	4FE4S_FER_1	PS00198	4Fe-4S ferredoxin-type iron-sulfur binding region signature.	FER_CLOPA	9-20 38-49	2	A:8-19 A:37-48
2	4FE4S_FER_2	PS51379	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	FER_CLOPA	29-56 1-28	1	A:28-55 -

Exons (0, 0)

(no "Exon" information available for 1CLF)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:55
 aligned with FER_CLOPA | P00195 from UniProtKB/Swiss-Prot  Length:56

    Alignment length:55
                                    11        21        31        41        51     
             FER_CLOPA    2 AYKIADSCVSCGACASECPVNAISQGDSIFVIDADTCIDCGNCANVCPVGAPVQE 56
               SCOP domains d1clfa_ A: Ferredoxin II                                SCOP domains
               CATH domains 1clfA00 A:1-55  [code=3.30.70.20, no name defined]      CATH domains
               Pfam domains ------------------------------------------------------- Pfam domains
         Sec.struct. author ......................eee....eee....................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------4FE4S_FER_1 -----------------4FE4S_FER_1 ------- PROSITE (1)
                PROSITE (2) 4FE4S_FER_2  PDB: -        4FE4S_FER_2  PDB: A:28-55    PROSITE (2)
                 Transcript ------------------------------------------------------- Transcript
                  1clf A  1 AYKIADSCVSCGACASECPVNAISQGDSIFVIDADTCIDCGNCANVCPVGAPVQE 55
                                    10        20        30        40        50

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: 4Fe-4S ferredoxins (143)

Family: Short-chain ferredoxins (11)

Protein domain: Ferredoxin II (7)

Clostridium pasteurianum [TaxId: 1501] (1)

d1clfa_

CATH Domains (1, 1)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-Beta Plaits (1688)

Homologous Superfamily: [code=3.30.70.20, no name defined] (120)

Clostridium pasteurianum. Organism_taxid: 1501. Strain: winogradsky. (1)

1clfA00

A:1-55

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 1CLF)

Gene Ontology (5, 5)

NMR Structure(hide GO term definitions)

Chain A (FER_CLOPA | P00195)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1clf)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1clf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FER_CLOPA \| P00195
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FER_CLOPA \| P00195
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 3)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File