Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  CATESTATIN
 
Authors :  S. K. Tsigelny, S. K. Mahata, L. Taupenot, N. E. Preece, M. Mahata, I. Khan, R. J. Parmer, D. T. O'Connor
Date :  19 Mar 99  (Deposition) - 22 Mar 99  (Release) - 01 Apr 03  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Chromogranin, Catestatin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Tsigelny, S. K. Mahata, L. Taupenot, N. E. Preece, M. Mahata, I. Khan, R. J. Parmer, D. T. O'Connor
Mechanism Of Action Of Chromogranin A On Catecholamine Release: Molecular Modeling Of The Catestatin Region Reveals A Beta-Strand/Loop/Beta-Strand Structure Secured By Hydrophobic Interactions And Predictive Of Activity.
Regul. Pept. V. 77 43 1998
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (BOVINE CHROMOGRANIN A)
    CellCHROMAFFIN CELL
    Cellular LocationCHROMAFFIN GRANULE
    ChainsA
    FragmentCATESTATIN, RESIDUES 341-371
    OrganADRENAL MEDULLA
    OrganelleCHROMAFFIN GRANULE
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Other DetailsCATECHOLAMINE RELEASE INHIBITORY REGION (NICOTINIC CHOLINERGIC ANTAGONIST) OF BOVINE CHROMOGRANIN A
    Other Details - SourceHOMOLOGY MODEL OF CATECHOLAMINE RELEASE INHIBITORY REGION OF BOVINE CHROMOGRANIN A (RESIDUES 341- 371)
    SecretionENDOCRINE
    SynonymNICOTINIC CHOLINERGIC ANTAGONIST

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CFK)

(-) Sites  (0, 0)

(no "Site" information available for 1CFK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CFK)

(-) Cis Peptide Bonds  (1, 1)

Theoretical Model
No.Residues
1Arg A:29 -Pro A:30

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CFK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1CFK)

(-) Exons   (0, 0)

(no "Exon" information available for 1CFK)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:31
 aligned with CMGA_BOVIN | P05059 from UniProtKB/Swiss-Prot  Length:449

    Alignment length:31
                                   368       378       388 
           CMGA_BOVIN   359 DPDRSMRLSFRARGYGFRGPGLQLRRGWRPN 389
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains ------------------------------- Pfam domains
         Sec.struct. author ............................... Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                 1cfk A   1 DPDRSMRLSFRARGYGFRGPGLQLRRGWRPN  31
                                    10        20        30 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1CFK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1CFK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CFK)

(-) Gene Ontology  (24, 24)

Theoretical Model(hide GO term definitions)
Chain A   (CMGA_BOVIN | P05059)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0050830    defense response to Gram-positive bacterium    Reactions triggered in response to the presence of a Gram-positive bacterium that act to protect the cell or organism.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
    GO:0045576    mast cell activation    The change in morphology and behavior of a mast cell resulting from exposure to a cytokine, chemokine, soluble factor, or to (at least in mammals) an antigen which the mast cell has specifically bound via IgE bound to Fc-epsilonRI receptors.
    GO:0002551    mast cell chemotaxis    The movement of a mast cell in response to an external stimulus.
    GO:0032762    mast cell cytokine production    Any process that contributes to cytokine production by a mast cell.
    GO:0043303    mast cell degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine, serotonin, and neutral proteases by a mast cell.
    GO:0016525    negative regulation of angiogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of angiogenesis.
    GO:0033604    negative regulation of catecholamine secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of a catecholamine.
    GO:0046888    negative regulation of hormone secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of a hormone from a cell.
    GO:0046676    negative regulation of insulin secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of insulin.
    GO:2000707    positive regulation of dense core granule biogenesis    Any process that activates or increases the frequency, rate or extent of dense core granule biogenesis.
    GO:0030155    regulation of cell adhesion    Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
cellular component
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0042629    mast cell granule    Coarse, bluish-black staining cytoplasmic granules, bounded by a plasma membrane and found in mast cells and basophils. Contents include histamine, heparin, chondroitin sulfates, chymase and tryptase.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030141    secretory granule    A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.
    GO:0030133    transport vesicle    Any of the vesicles of the constitutive secretory pathway, which carry cargo from the endoplasmic reticulum to the Golgi, between Golgi cisternae, from the Golgi to the ER (retrograde transport) or to destinations within or outside the cell.
    GO:0030658    transport vesicle membrane    The lipid bilayer surrounding a transport vesicle.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cfk)
 
  Sites
(no "Sites" information available for 1cfk)
 
  Cis Peptide Bonds
    Arg A:29 - Pro A:30   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cfk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CMGA_BOVIN | P05059
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CMGA_BOVIN | P05059
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CMGA_BOVIN | P050591n2y

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CFK)