|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1CEJ) |
Sites (0, 0)| (no "Site" information available for 1CEJ) |
SS Bonds (6, 6)
NMR Structure
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1CEJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1CEJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1CEJ) |
Exons (0, 0)| (no "Exon" information available for 1CEJ) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:96 aligned with MSP1_PLAFW | P04933 from UniProtKB/Swiss-Prot Length:1639 Alignment length:96 1535 1545 1555 1565 1575 1585 1595 1605 1615 MSP1_PLAFW 1526 NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSYPLFDGIFCSSSN 1621 SCOP domains d1ceja1 A:1-45 d1ceja2 A:46-96 Merozoite surface protein 1 (MSP-1) SCOP domains CATH domains 1cejA01 A:1-44 Laminin 1cejA02 A:45-96 Laminin CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 1cej A 1 NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSYPLFDGIFCSSSN 96 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1CEJ) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (MSP1_PLAFW | P04933)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|