Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF A CYANOGENIC BETA-GLUCOSIDASE FROM WHITE CLOVER (TRIFOLIUM REPENS L.), A FAMILY 1 GLYCOSYL-HYDROLASE
 
Authors :  T. E. Barrett, C. G. Suresh, S. P. Tolley, M. A. Hughes
Date :  31 Jul 95  (Deposition) - 15 Oct 95  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Cyanogenic Beta-Glucosidase, Hydrolase (O-Glycosyl) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Barrett, C. G. Suresh, S. P. Tolley, E. J. Dodson, M. A. Hughes
The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover, A Family 1 Glycosyl Hydrolase.
Structure V. 3 951 1995
PubMed-ID: 8535788  |  Reference-DOI: 10.1016/S0969-2126(01)00229-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYANOGENIC BETA-GLUCOSIDASE
    Chains: A
    EC Number: 3.2.1.21
    Organ: LEAVES
    Organism Common: WHITE CLOVER
    Organism Scientific: TRIFOLIUM REPENS
    Organism Taxid: 3899
    Tissue: LEAVES
    Variant: L

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CBG)

(-) Sites  (0, 0)

(no "Site" information available for 1CBG)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:202 -A:210

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ala A:198 -Pro A:199
2Trp A:446 -Ser A:447

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1CBG)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GLYCOSYL_HYDROL_F1_2PS00653 Glycosyl hydrolases family 1 N-terminal signature.BGLT_TRIRP34-48  1A:23-37
2GLYCOSYL_HYDROL_F1_1PS00572 Glycosyl hydrolases family 1 active site.BGLT_TRIRP404-412  1A:393-401
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GLYCOSYL_HYDROL_F1_2PS00653 Glycosyl hydrolases family 1 N-terminal signature.BGLT_TRIRP34-48  2A:23-37
2GLYCOSYL_HYDROL_F1_1PS00572 Glycosyl hydrolases family 1 active site.BGLT_TRIRP404-412  2A:393-401

(-) Exons   (0, 0)

(no "Exon" information available for 1CBG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:490
 aligned with BGLT_TRIRP | P26205 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:490
                                                                                                                                                                                                                                                                                                                                                                                                                                                               425                                                                    
                                                                                                                                                                                                                                                                                                                                                                                                                                          412 413     421   422  |                                                                    
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411|   |  418  |    423 |       -         -         -         -         -         -         -
           BGLT_TRIRP    12 FKPLPISFDDFSDLNRSCFAPGFVFGTASSAFQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDEYHRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYYNNLINEVLANGMQPYVTLFHWDVPQALEDEYRGFLGRNIVDDFRDYAELCFKEFGDRVKHWITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYLAAHYQLLAHAAAARLYKTKYQASQNGIIGITLVSHWFEPASKEKADVDAAKRGLDFMLGWFMHPLTKGRYPESMRYLVRKRLPKFSTEESKELTGSFDFLGLNYYSSYYAAKAPRIPNARPAIQTDSLINATFEHNGKPLGPMAASSWLCIYPQGIRKLLLYVKNHYNNPVIYITENGRN---SSTINTVTS-----RIPF--------------------------------------------------------------------   -
               SCOP domains d1cbga_ A: Plant beta-glucosidase (myrosinase)                                                                                                                                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 1cbgA00 A:1-490 Glycosidases                                                                                                                                                                                                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................eeeee..................hhhhhhhhh...............hhhhhhhhhhhhhh....eeeee................hhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhh.....hhhhhhhhhhhhhhhhhh....eee....hhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..........hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.......hhhhhhhh....eeeee...eeeeee................eeee......................hhhhhhhhhhhhhh...eeeee...........hhhhhh..hhhhhhhhhhhhhhhhhhhhhh.eeeeee............................eeee..hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------GLYCOSYL_HYDROL-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GLYCOSYL_----------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cbg A   1 FKPLPISFDDFSDLNRSCFAPGFVFGTASSAFQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDEYHRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYYNNLINEVLANGMQPYVTLFHWDVPQALEDEYRGFLGRNIVDDFRDYAELCFKEFGDRVKHWITLNEPWGVSMNAYAYGTFAPGRCSDWLKLNCTGGDSGREPYLAAHYQLLAHAAAARLYKTKYQASQNGIIGITLVSHWFEPASKEKADVDAAKRGLDFMLGWFMHPLTKGRYPESMRYLVRKRLPKFSTEESKELTGSFDFLGLNYYSSYYAAKAPRIPNARPAIQTDSLINATFEHNGKPLGPMAASSWLCIYPQGIRKLLLYVKNHYNNPVIYITENGRNEFNDPTLSLQESLLDTPRIDYYYRHLYYVLTAIGDGVNVKGYFAWSLFDNMEWDSGYTVRFGLVFVDFKNNLKRHPKLSAHWFKSFLKK 490
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CBG)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A   (BGLT_TRIRP | P26205)
molecular function
    GO:0008422    beta-glucosidase activity    Catalysis of the hydrolysis of terminal, non-reducing beta-D-glucose residues with release of beta-D-glucose.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
    GO:0102483    scopolin beta-glucosidase activity    Catalysis of the reaction: H2O + scopolin <=> beta-D-glucose + scopoletin
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cbg)
 
  Sites
(no "Sites" information available for 1cbg)
 
  Cis Peptide Bonds
    Ala A:198 - Pro A:199   [ RasMol ]  
    Trp A:446 - Ser A:447   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cbg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BGLT_TRIRP | P26205
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.21
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BGLT_TRIRP | P26205
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1CBG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CBG)