|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1C8A) |
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1C8A) |
Cis Peptide Bonds (2, 2)
NMR Structure
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1C8A) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1C8A) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:134 aligned with ANP3_LYCDA | P35753 from UniProtKB/Swiss-Prot Length:134 Alignment length:134 10 20 30 40 50 60 70 80 90 100 110 120 130 ANP3_LYCDA 1 NKASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYEDGTTSPGLKSVVANQLIPINTALTLVMMKAEEVSPKGIPSEEISKLVGMQVNRAVYLDQTLMPDMVKNYE 134 SCOP domains d1c8aa1 A:1-68 Type III antifreeze protein, AFP III d1c8aa2 A:69-134 Type III antifreeze protein, AFP III SCOP domains CATH domains 1c8aA01 A:1-66 Type Iii Antifreeze Protein Isoform Hplc 12 ----1c8aA02 A:71-134 Type Iii Antifreeze Protein Isoform Hplc 12 CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---AFP_LIKE PDB: A:4-63 UniProt: 4-63 ----------AFP_LIKE PDB: A:74-133 UniProt: 74-133 - PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1c8a A 1 NKASVVANQLIPINTALTLIMMKAEVVTPMGIPAEEIPNLVGMQVNRAVPLGTTLMPDMVKNYEDGTTSPGLKSVVANQLIPINTALTLVMMKAEEVSPKGIPSEEISKLVGMQVNRAVYLDQTLMPDMVKNYE 134 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 2)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1C8A) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (ANP3_LYCDA | P35753)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|