|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1C6O) |
(no "Cis Peptide Bond" information available for 1C6O) |
(no "SAP(SNP)/Variant" information available for 1C6O) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1C6O) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with CYC6_TETOB | P57736 from UniProtKB/Swiss-Prot Length:89 Alignment length:89 10 20 30 40 50 60 70 80 CYC6_TETOB 1 SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW 89 SCOP domains d1c6oa_ A: Cytochrome c6 (synonym: cytochrome c553) SCOP domains CATH domains 1c6oA00 A:1-89 Cytochrome c CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTC PDB: A:2-84 UniProt: 2-84 ----- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1c6o A 1 SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW 89 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:89 aligned with CYC6_TETOB | P57736 from UniProtKB/Swiss-Prot Length:89 Alignment length:89 10 20 30 40 50 60 70 80 CYC6_TETOB 1 SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW 89 SCOP domains d1c6ob_ B: Cytochrome c6 (synonym: cytochrome c553) SCOP domains CATH domains 1c6oB00 B:1-89 Cytochrome c CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTC PDB: B:2-84 UniProt: 2-84 ----- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 1c6o B 1 SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAITYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW 89 10 20 30 40 50 60 70 80
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1C6O) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CYC6_TETOB | P57736)
|
|
|
|
|
|
|