Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE (BPHD) FROM RHODOCOCCUS SP. STRAIN RHA1
 
Authors :  N. Nandhagopal, T. Senda, Y. Mitsui
Date :  30 Sep 99  (Deposition) - 01 Oct 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (8x)
Keywords :  Hydrolase, Pcb Degradation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. Nandhagopal, T. Senda, T. Hatta, A. Yamada, E. Masai, M. Fukuda, Y. Mitsui
Three-Dimensional Structure Of Microbial 2-Hydroxyl-6-Oxo-6-Phenylhexa-2, 4- Dienoic Acid (Hpda) Hydrolase (Bphd Enzyme) From Rhodococcus Sp. Strain Rha1, I The Pcb Degradation Pathway
Proc. Jpn. Acad. , Ser. B V. 73 154 1997
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN (2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-DIENOATE HYDROLASE)
    Chains: A
    EC Number: 3.7.1.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: RHODOCOCCUS SP.
    Organism Taxid: 101510
    Strain: RHA1
    Synonym: BPHD

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (8x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1C4X)

(-) Sites  (0, 0)

(no "Site" information available for 1C4X)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1C4X)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1C4X)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1C4X)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1C4X)

(-) Exons   (0, 0)

(no "Exon" information available for 1C4X)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:281
 aligned with O05149_RHOSO | O05149 from UniProtKB/TrEMBL  Length:285

    Alignment length:281
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283 
         O05149_RHOSO     4 TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 284
               SCOP domains d1c4xa_ A: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)                                                                                                                                                                                                                     SCOP domains
               CATH domains 1c4xA00 A:3-283  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee......eeeeee......eeeee.......hhhhhhh.hhhhhhh..eeeee................hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhh...eeeeeee..........hhhhhhhhhhhhh.hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhh.....eeeeee.......hhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1c4x A   3 TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 283
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282 


Chain A from PDB  Type:PROTEIN  Length:281
 aligned with Q75WN8_RHOJR | Q75WN8 from UniProtKB/TrEMBL  Length:285

    Alignment length:281
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283 
         Q75WN8_RHOJR     4 TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 284
               SCOP domains d1c4xa_ A: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)                                                                                                                                                                                                                     SCOP domains
               CATH domains 1c4xA00 A:3-283  [code=3.40.50.1820, no name defined]                                                                                                                                                                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee......eeeeee......eeeee.......hhhhhhh.hhhhhhh..eeeee................hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhh...eeeeeee..........hhhhhhhhhhhhh.hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhh.....eeeeee.......hhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1c4x A   3 TVEIIEKRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAENFFVVAPDLIGFGQSEYPETYPGHIMSWVGMRVEQILGLMNHFGIEKSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPRLTPYRELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRCGHWAQLERWDAMGPMLMEHFRA 283
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1C4X)

(-) Gene Ontology  (2, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (O05149_RHOSO | O05149)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

Chain A   (Q75WN8_RHOJR | Q75WN8)
molecular function
    GO:0018774    2,6-dioxo-6-phenylhexa-3-enoate hydrolase activity    Catalysis of the reaction: 2,6-dioxo-6-phenylhexa-3-enoate + H2O = benzoate + 2-oxopent-4-enoate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c4x)
 
  Sites
(no "Sites" information available for 1c4x)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1c4x)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1c4x
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O05149_RHOSO | O05149
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q75WN8_RHOJR | Q75WN8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.7.1.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O05149_RHOSO | O05149
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q75WN8_RHOJR | Q75WN8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1C4X)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1C4X)