|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 1C4E) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (1, 20)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1C4E) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1C4E) |
Exons (0, 0)| (no "Exon" information available for 1C4E) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:35 aligned with GUR_GYMSY | P25810 from UniProtKB/Swiss-Prot Length:35 Alignment length:35 10 20 30 GUR_GYMSY 1 QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG 35 SCOP domains d1c4ea_ A: SCOP domains CATH domains ----------------------------------- CATH domains Pfam domains ----------------------------------- Pfam domains SAPs(SNPs) ----------------------------------- SAPs(SNPs) PROSITE ----------------------------------- PROSITE Transcript ----------------------------------- Transcript 1c4e A 1 xQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG 35 | 10 20 30 | 1-PCA
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1C4E) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1C4E) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1C4E)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|