|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (0, 0)| (no "Site" information available for 1C2U) |
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1C2U) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1C2U) |
PROSITE Motifs (1, 1)| NMR Structure (1, 1) |
Exons (0, 0)| (no "Exon" information available for 1C2U) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:35 aligned with K1A_STIHL | P29187 from UniProtKB/Swiss-Prot Length:35 Alignment length:35 10 20 30 K1A_STIHL 1 RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC 35 SCOP domains d1c2ua_ A: Sea anemone toxin k SCOP domains CATH domains ----------------------------------- CATH domains Pfam domains ----------------------------------- Pfam domains SAPs(SNPs) ----------------------------------- SAPs(SNPs) PROSITE --SHKT PDB: A:4-34 UniProt: 3-35 PROSITE Transcript ----------------------------------- Transcript 1c2u A 1 RSaIDTIPKSRCTAFQCKHSAKYRLSFCRKTCGTa 35 | 10 20 30 | | 35-ABA 3-ABA
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1C2U) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1C2U) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (K1A_STIHL | P29187)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|