Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MUCONATE LACTONIZING ENZYME FROM PSEUDOMONAS PUTIDA
 
Authors :  M. S. Hasson, I. Schlichting, J. Moulai, K. Taylor, W. Barrett, G. L. Ken P. C. Babbitt, J. A. Gerlt, G. A. Petsko, D. Ringe
Date :  07 Jul 98  (Deposition) - 21 Oct 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,C  (4x)
Biol. Unit 2:  B  (8x)
Keywords :  Muconate Lactonizing Enzyme, Muconate Cycloisomerase Aromatic Hydrocarbons Catabolism, Isomerase, Muconate Cycloisomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. S. Hasson, I. Schlichting, J. Moulai, K. Taylor, W. Barrett, G. L. Kenyon, P. C. Babbitt, J. A. Gerlt, G. A. Petsko, D. Ringe
Evolution Of An Enzyme Active Site: The Structure Of A New Crystal Form Of Muconate Lactonizing Enzyme Compared With Mandelate Racemase And Enolase.
Proc. Natl. Acad. Sci. Usa V. 95 10396 1998
PubMed-ID: 9724714  |  Reference-DOI: 10.1073/PNAS.95.18.10396

(-) Compounds

Molecule 1 - MUCONATE LACTONIZING ENZYME
    ChainsA, B, C
    CollectionATCC 12633
    EC Number5.5.1.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPKK223-2
    Expression System StrainJM105
    Expression System Taxid562
    GeneCATB
    Organism ScientificPSEUDOMONAS PUTIDA
    Organism Taxid303
    SynonymMUCONATE CYCLOISOMERASE

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (4x)A C
Biological Unit 2 (8x) B 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BKH)

(-) Sites  (0, 0)

(no "Site" information available for 1BKH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BKH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BKH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BKH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BKH)

(-) Exons   (0, 0)

(no "Exon" information available for 1BKH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:358
 aligned with Q51958_PSEPU | Q51958 from UniProtKB/TrEMBL  Length:373

    Alignment length:369
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
         Q51958_PSEPU     4 ALIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEEAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
               SCOP domains d1bkha2 A:4-130            Muconate-lactonizing enzyme (cis muconate cycloisomerase)                                           d1bkha1 A:131-372 Muconate-lactonizing enzyme                                                                                                                                                                                                      SCOP domains
               CATH domains 1bkhA01 A:4-121,           A:358-371 Enolase-like, N-terminal domain                                                  1bkhA02 A:122-357 Enolase superfamily                                                                                                                                                                                                       1bkhA01       - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeee...-----------.eeeeeeeeee....eeeeeee...........hhhhhhhhhh.hhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhh.......eee.........hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhh...eee.......hhhhhhhhhh...eee.......hhhhhhhhhh....eeee.hhhh..hhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhh...........hhhh..........eee..eee............hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bkh A   4 ALIERIDAIIVDLPTI-----------QQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
                                    13     |   -       |33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
                                          19          31                                                                                                                                                                                                                                                                                                                                                     

Chain B from PDB  Type:PROTEIN  Length:361
 aligned with Q51958_PSEPU | Q51958 from UniProtKB/TrEMBL  Length:373

    Alignment length:369
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
         Q51958_PSEPU     4 ALIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEEAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
               SCOP domains d1bkhb2 B:4-130 Mu        conate-lactonizing enzyme (cis muconate cycloisomerase)                                              d1bkhb1 B:131-372 Muconate-lactonizing enzyme                                                                                                                                                                                                      SCOP domains
               CATH domains 1bkhB01 B:4-121,B:        358-371 Enolase-like, N-terminal domain                                                     1bkhB02 B:122-357 Enolase superfamily                                                                                                                                                                                                       1bkhB01       - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee....--------.eeeeeeeeeee....eeeeeee...........hhhhhhhhhh.hhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhh.......eee.........hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhh....eee.......hhhhhhhhhh...eee.......hhhhhhhhhh....eeee.hhhh..hhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhh...........hhhh..........eee..eee............hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bkh B   4 ALIERIDAIIVDLPTIRP--------QQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
                                    13       | -      | 33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
                                            21       30                                                                                                                                                                                                                                                                                                                                                      

Chain C from PDB  Type:PROTEIN  Length:359
 aligned with Q51958_PSEPU | Q51958 from UniProtKB/TrEMBL  Length:373

    Alignment length:369
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
         Q51958_PSEPU     4 ALIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEEAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
               SCOP domains d1bkhc2 C:4-130           Muconate-lactonizing enzyme (cis muconate cycloisomerase)                                            d1bkhc1 C:131-372 Muconate-lactonizing enzyme                                                                                                                                                                                                      SCOP domains
               CATH domains 1bkhC01 C:4-121,          C:358-371 Enolase-like, N-terminal domain                                                   1bkhC02 C:122-357 Enolase superfamily                                                                                                                                                                                                       1bkhC01       - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee..----------.eeeeeeeeeee....eeeeeee...........hhhhhhhhhh.hhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhh.......eee.........hhhhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhh...eee.......hhhhhhhhhh...eee.......hhhhhhhhhh....eeee.hhhh..hhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhh...........hhhh..........eee..eee............hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1bkh C   4 ALIERIDAIIVDLPTI----------QQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR 372
                                    13     |   -      | 33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363         
                                          19         30                                                                                                                                                                                                                                                                                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BKH)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (Q51958_PSEPU | Q51958)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0018850    chloromuconate cycloisomerase activity    Catalysis of the reaction: 2-chloro-2,5-dihydro-5-oxofuran-2-acetate = 3-chloro-cis,cis-muconate.
    GO:0030145    manganese ion binding    Interacting selectively and non-covalently with manganese (Mn) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0018849    muconate cycloisomerase activity    Catalysis of the reaction: 2,5-dihydro-5-oxofuran-2-acetate = cis,cis-hexadienedioate.
biological process
    GO:0009063    cellular amino acid catabolic process    The chemical reactions and pathways resulting in the breakdown of amino acids, organic acids containing one or more amino substituents.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bkh)
 
  Sites
(no "Sites" information available for 1bkh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bkh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bkh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q51958_PSEPU | Q51958
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  5.5.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q51958_PSEPU | Q51958
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q51958_PSEPU | Q519581f9c

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BKH)