Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SHK-DNP22: A POTENT KV1.3-SPECIFIC IMMUNOSUPPRESSIVE POLYPEPTIDE, NMR, 20 STRUCTURES
 
Authors :  K. Kalman, M. W. Pennington, M. D. Lanigan, A. Nguyen, H. Rauer, V. Mahnir, G. A. Gutman, K. Paschetto, W. R. Kem, S. Grissmer, E. P. Christian, M. D. Cahalan, R. S. Norton, K. G. Chandy
Date :  14 May 98  (Deposition) - 02 Dec 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Potassium Channel Inhibitor, Sea Anemone, Immunosuppressant Neurotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Kalman, M. W. Pennington, M. D. Lanigan, A. Nguyen, H. Rauer, V. Mahnir, K. Paschetto, W. R. Kem, S. Grissmer, G. A. Gutman, E. P. Christian, M. D. Cahalan, R. S. Norton, K. G. Chandy
Shk-Dap22, A Potent Kv1. 3-Specific Immunosuppressive Polypeptide.
J. Biol. Chem. V. 273 32697 1998
PubMed-ID: 9830012  |  Reference-DOI: 10.1074/JBC.273.49.32697
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POTASSIUM CHANNEL TOXIN SHK
    Chains: A
    Engineered: YES
    Mutation: YES
    Organism Scientific: STICHODACTYLA HELIANTHUS
    Organism Taxid: 6123
    Synonym: SHK-DNP22

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1DNP1Mod. Amino Acid3-AMINO-ALANINE

(-) Sites  (0, 0)

(no "Site" information available for 1BEI)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:3 -A:35
2A:12 -A:28
3A:17 -A:32

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BEI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BEI)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SHKTPS51670 ShKT domain profile.K1A_STIHL3-35  1A:3-35

(-) Exons   (0, 0)

(no "Exon" information available for 1BEI)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:35
 aligned with K1A_STIHL | P29187 from UniProtKB/Swiss-Prot  Length:35

    Alignment length:35
                                    10        20        30     
             K1A_STIHL    1 RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC 35
               SCOP domains d1beia_ A: Sea anemone toxin k      SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .............hhhhhh.hhhh....hhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE --SHKT  PDB: A:3-35 UniProt: 3-35   PROSITE
                 Transcript ----------------------------------- Transcript
                  1bei A  1 RSCIDTIPKSRCTAFQCKHSMaYRLSFCRKTCGTC 35
                                    10        20 |      30     
                                                22-DNP
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1BEI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BEI)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (K1A_STIHL | P29187)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0042151    nematocyst    An organelle found in cnidoblast (nematoblast) cells. When matured, these stinging organelles store toxins and can deliver them when the cnidocil (a short extension of the cnidocyst) is stimulated by a prey or another stimulus.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DNP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1bei)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bei)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bei
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  K1A_STIHL | P29187
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  K1A_STIHL | P29187
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        K1A_STIHL | P29187: 1c2u 1roo 2k9e 4lfq 4lfs 4z7p 5i5a 5i5b 5i5c

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BEI)