Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  GLUTAMATE MUTASE (B12-BINDING SUBUNIT), NMR, MINIMIZED AVERAGE STRUCTURE
 
Authors :  M. Tollinger, R. Konrat, B. H. Hilbert, E. N. G. Marsh, B. Kraeutler
Date :  19 May 98  (Deposition) - 26 Aug 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Isomerase, Glutamate Mutase, B12-Binding Subunit (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Tollinger, R. Konrat, B. H. Hilbert, E. N. Marsh, B. Krautler
How A Protein Prepares For B12 Binding: Structure And Dynamics Of The B12-Binding Subunit Of Glutamate Mutase From Clostridium Tetanomorphum
Structure V. 6 1021 1998
PubMed-ID: 9739092  |  Reference-DOI: 10.1016/S0969-2126(98)00103-8
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUTAMATE MUTASE
    Atcc: ATCC 15920
    Chains: A
    Collection: ATCC 15920
    EC Number: 5.4.99.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Gene: MUTS
    Expression System Plasmid: PMUTSX
    Expression System Strain: BL12 (DE3)
    Expression System Taxid: 562
    Expression System Vector: PT7-7
    Expression System Vector Type: PLASMID
    Fragment: B12-BINDING SUBUNIT
    Gene: MUTS
    Organism Scientific: CLOSTRIDIUM TETANOMORPHUM
    Organism Taxid: 1553
    Strain: H1
    Synonym: MUTS

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BE1)

(-) Sites  (0, 0)

(no "Site" information available for 1BE1)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BE1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BE1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BE1)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1B12_BINDINGPS51332 B12-binding domain profile.GMSS_CLOTT3-137  1A:3-137

(-) Exons   (0, 0)

(no "Exon" information available for 1BE1)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with GMSS_CLOTT | Q05488 from UniProtKB/Swiss-Prot  Length:137

    Alignment length:137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       
           GMSS_CLOTT     1 MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE 137
               SCOP domains d1be1a_ A: Glutamate mutase, small subunit                                                                                                SCOP domains
               CATH domains 1be1A00 A:1-137  [code=3.40.50.280, no name defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee......................eeeee.....hhhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhh......eeeee..........hhhhhhhhhh..eeee.....hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --B12_BINDING  PDB: A:3-137 UniProt: 3-137                                                                                                PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1be1 A   1 MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BE1)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (GMSS_CLOTT | Q05488)
molecular function
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0016866    intramolecular transferase activity    Catalysis of the transfer of a functional group from one position to another within a single molecule.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0050097    methylaspartate mutase activity    Catalysis of the reaction: threo-3-methyl-L-aspartate = L-glutamate.
biological process
    GO:0019670    anaerobic glutamate catabolic process    The anaerobic chemical reactions and pathways resulting in the breakdown of glutamate, yielding energy in the form of ATP.
    GO:0019553    glutamate catabolic process via L-citramalate    The chemical reactions and pathways resulting in the breakdown of glutamate, via the intermediate L-citramalate.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1be1)
 
  Sites
(no "Sites" information available for 1be1)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1be1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1be1
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GMSS_CLOTT | Q05488
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.4.99.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GMSS_CLOTT | Q05488
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GMSS_CLOTT | Q05488: 1fmf 1id8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BE1)