Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CIRCULARLY PERMUTED BB2-CRYSTALLIN
 
Authors :  G. Wright, A. K. Basak, E. -M. Mayr, R. Glockshuber, C. Slingsby
Date :  12 May 98  (Deposition) - 21 Oct 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.78
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Eye-Lens Protein, Beta-Crystallin B, Multigene Family (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Wright, A. K. Basak, K. Wieligmann, E. M. Mayr, C. Slingsby
Circular Permutation Of Betab2-Crystallin Changes The Hierarchy Of Domain Assembly.
Protein Sci. V. 7 1280 1998
PubMed-ID: 9655330
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CIRCULARLY PERMUTED BB2-CRYSTALLIN
    Cell Line: BL21
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PETCPBB2
    Expression System Strain: BL21 (DE3) PLYSS
    Expression System Taxid: 562
    Expression System Vector: PET11A
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Other Details: PROTEIN IN THE CRYSTAL LATTICE IS A DIMER
    Tissue: EYE-LENS

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BD7)

(-) Sites  (0, 0)

(no "Site" information available for 1BD7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BD7)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:40 -Pro A:41
2Gly B:40 -Pro B:41

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BD7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BD7)

(-) Exons   (0, 0)

(no "Exon" information available for 1BD7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:176
                                                                                                                                                                                                                 
               SCOP domains d1bd7a_ A: beta-Crystallin                                                                                                                                                       SCOP domains
               CATH domains -1bd7A01 A:88-172 Crystallins                                                          ----1bd7A02 A:1-82 Crystallins                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeeeeeee.......hhh.......eeee...eeeeeeehhheeeeeee..eee..hhhh........eeeee.......eeeee..hhh...eeee......hhhh......eeeeee..eeeeee...eeeeeee..eee..hhh...........eee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bd7 A   87 EHKIILYENPNFTGKKMEIVDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDNSDFGAPHPQVQSVRRIRDMQGNPKIIIFEQENFQGHSHELSGPCPNLKETGMEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIK   82
                                    96       106|      116  |    125       135       145       155       165       175||       9        19       28A        38        48        58        68  | |   76      
                                             106A     114|  |                                                      175||                         28A                                        70A |           
                                                       116  |                                                        -1|                                                                      71A           
                                                         118A                                                          1                                                                                    


Chain B from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                            
               SCOP domains d1bd7b_ B: beta-Crystallin                                                                                                                                                  SCOP domains
               CATH domains -1bd7B01 B:88-172 Crystallins                                                          ----1bd7B02 B:1-81 Crystallins                                                     - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeeeeeee.......hhh.......eeee...eeeeeee...eeeeeee..eee..hhhh........eeeee.......eeeeeeehhheeeeeee......hhhh......eeeeee..eeeeee...eeeeeee..eee..hhh......eee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1bd7 B   87 EHKIILYENPNFTGKKMEIVDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDNSDFGAPHPQVQSVRRIRDMQGNPKIIIFEQENFQGHSHELSGPCPNLKETGMEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTDSLSSLRPIK   82
                                    96       106|      116  |    125       135       145       155       165       175||       9        19       28A        38        48        58        68||      81 
                                             106A     114|  |                                                      175||                         28A                                       69|         
                                                       116  |                                                        -1|                                                                    73         
                                                         118A                                                          1
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BD7)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bd7)
 
  Sites
(no "Sites" information available for 1bd7)
 
  Cis Peptide Bonds
    Gly A:40 - Pro A:41   [ RasMol ]  
    Gly B:40 - Pro B:41   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bd7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CRBB2_RAT | P62697
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CRBB2_RAT | P62697
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1BD7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BD7)