Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  CYTOHESIN-1/B2-1 SEC7 DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE
 
Authors :  S. F. Betz, A. Schnuchel, H. Wang, E. T. Olejniczak, R. P. Meadows, S. W. Fesik
Date :  06 May 98  (Deposition) - 11 May 99  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Exchange Factor, Integrin Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. F. Betz, A. Schnuchel, H. Wang, E. T. Olejniczak, R. P. Meadows, B. P. Lipsky, E. A. Harris, D. E. Staunton, S. W. Fesik
Solution Structure Of The Cytohesin-1 (B2-1) Sec7 Domain And Its Interaction With The Gtpase Adp Ribosylation Factor 1.
Proc. Natl. Acad. Sci. Usa V. 95 7909 1998
PubMed-ID: 9653114  |  Reference-DOI: 10.1073/PNAS.95.14.7909
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOHESIN-1
    Cell Line: BL21
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Gene: B2-1
    Expression System Plasmid: PET-20B
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: SEC7 DOMAIN,
    Gene: B2-1
    Organ: SPLEEN
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: B2-1, SEC7 HOMOLOG B2-1

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1BC9)

(-) Sites  (0, 0)

(no "Site" information available for 1BC9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BC9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BC9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BC9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BC9)

(-) Exons   (7, 7)

NMR Structure (7, 7)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003611011bENSE00001287973chr17:76778376-7677828493CYH1_HUMAN1-880--
1.7aENST000003611017aENSE00001674390chr17:76705814-7670573283CYH1_HUMAN8-35280--
1.8ENST000003611018ENSE00000745796chr17:76704343-7670427965CYH1_HUMAN36-57221A:57-571
1.9bENST000003611019bENSE00000949392chr17:76698686-7669862067CYH1_HUMAN57-79231A:57-7923
1.10ENST0000036110110ENSE00001731743chr17:76698322-76698204119CYH1_HUMAN80-119401A:80-11940
1.11bENST0000036110111bENSE00000949394chr17:76697833-7669775381CYH1_HUMAN119-146281A:119-14628
1.12cENST0000036110112cENSE00002171956chr17:76696525-76696413113CYH1_HUMAN146-184391A:146-18439
1.13ENST0000036110113ENSE00000745793chr17:76695050-76694902149CYH1_HUMAN184-233501A:184-23350
1.14bENST0000036110114bENSE00001662887chr17:76694462-76694350113CYH1_HUMAN234-271381A:234-25623
1.16bENST0000036110116bENSE00001753312chr17:76688577-7668849979CYH1_HUMAN271-297270--
1.17bENST0000036110117bENSE00001287897chr17:76677124-7667705372CYH1_HUMAN298-321240--
1.18ENST0000036110118ENSE00001287887chr17:76676426-76676272155CYH1_HUMAN322-373520--
1.20eENST0000036110120eENSE00001287965chr17:76672251-766701302122CYH1_HUMAN373-398260--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:200
 aligned with CYH1_HUMAN | Q15438 from UniProtKB/Swiss-Prot  Length:398

    Alignment length:200
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256
           CYH1_HUMAN    57 RKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTH 256
               SCOP domains d1bc9a_ A: Cytohesin-1/b2-1                                                                                                                                                                              SCOP domains
               CATH domains 1bc9A01 A:57-135  [code=1.10.220.20, no name defined]                          1bc9A02 A:136-256 Arf Nucleotide-binding Site Opener,domain 2                                                             CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhh..hhhhhhhhh.......hhhhhhhhh......hhhhhhh.....hhhhhhhhh...........hhhhhh.............hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhh..........hhhhhhhhhhh.......hhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1----------------------Exon 1.10  PDB: A:80-119 UniProt: 80-119--------------------------Exon 1.12c  PDB: A:146-184             -------------------------------------------------Exon 1.14b [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) Exon 1.9b  PDB: A:57-79---------------------------------------Exon 1.11b  PDB: A:119-146  -------------------------------------Exon 1.13  PDB: A:184-233 UniProt: 184-233        ----------------------- Transcript 1 (2)
                 1bc9 A  57 MKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPELEHHHHHH 256
                                    66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BC9)

(-) Gene Ontology  (14, 14)

NMR Structure(hide GO term definitions)
Chain A   (CYH1_HUMAN | Q15438)
molecular function
    GO:0005086    ARF guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with the GTPase ARF. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005085    guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0032012    regulation of ARF protein signal transduction    Any process that modulates the frequency, rate or extent of ARF protein signal transduction.
    GO:0030155    regulation of cell adhesion    Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0000139    Golgi membrane    The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0031234    extrinsic component of cytoplasmic side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1bc9)
 
  Sites
(no "Sites" information available for 1bc9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bc9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bc9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYH1_HUMAN | Q15438
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CYH1_HUMAN | Q15438
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYH1_HUMAN | Q15438: 4a4p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BC9)