Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  C-TERMINAL MEROZOITE SURFACE PROTEIN 1 FROM PLASMODIUM CYNOMOLGI
 
Authors :  G. A. Bentley, V. Chitarra, I. Holm, S. Longacre
Date :  15 Feb 99  (Deposition) - 24 May 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Msp-1, Candidate Malaria Vaccine, Surface Antigen, Surface Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  V. Chitarra, I. Holm, G. A. Bentley, S. Petres, S. Longacre
The Crystal Structure Of C-Terminal Merozoite Surface Protein 1 At 1. 8 A Resolution, A Highly Protective Malaria Vaccine Candidate.
Mol. Cell V. 3 457 1999
PubMed-ID: 10230398  |  Reference-DOI: 10.1016/S1097-2765(00)80473-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (MEROZOITE SURFACE PROTEIN 1)
    ChainsA
    EngineeredYES
    Expression SystemTRICHOPLUSIA NI
    Expression System CommonCABBAGE LOOPER
    Expression System Taxid7111
    Expression System VectorBACULOVIRUS
    FragmentTWO C-TERMINAL EGF-LIKE DOMAINS
    Organism ScientificPLASMODIUM CYNOMOLGI
    Organism Taxid5827
    Other DetailsSYNTHETIC GENE
    SynonymMSP1-19, MSA1-19

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1B9W)

(-) Sites  (0, 0)

(no "Site" information available for 1B9W)

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1A:7 -A:18
2A:30 -A:41
3A:49 -A:62
4A:56 -A:72
5A:74 -A:88

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1B9W)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1B9W)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1B9W)

(-) Exons   (0, 0)

(no "Exon" information available for 1B9W)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:91
 aligned with Q25659_9APIC | Q25659 from UniProtKB/TrEMBL  Length:379

    Alignment length:91
                                                                                                                  379  
                                   300       310       320       330       340       350       360       370        |- 
         Q25659_9APIC   291 MSSEHRCIDTNVPENAACYRYLDGTEEWRCLLYFKEDAGKCVPAPNMTCKDKNGGCAPEAECKMNDKNEIVCKCTKEGSEPLFEGVFCS--   -
               SCOP domains d1b9wa1 A:1-45                               d1b9wa2 A:46-89                             -- SCOP domains
               CATH domains 1b9wA01 A:1-51 Laminin                             1b9wA02 A:52-89 Laminin               -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh..........eeeee.....eeeee...eeee..eeee........hhhh.....eeee.....eeee.....eeeehhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 1b9w A   1 MSSEHRCIDTNVPENAACYRYLDGTEEWRCLLYFKEDAGKCVPAPNMTCKDKNGGCAPEAECKMNDKNEIVCKCTKEGSEPLFEGVFCSHH  91
                                    10        20        30        40        50        60        70        80        90 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1B9W)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q25659_9APIC | Q25659)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1b9w)
 
  Sites
(no "Sites" information available for 1b9w)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b9w)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1b9w
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q25659_9APIC | Q25659
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q25659_9APIC | Q25659
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1B9W)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1B9W)