|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1B8Z) |
(no "Site" information available for 1B8Z) |
(no "SS Bond" information available for 1B8Z) |
(no "Cis Peptide Bond" information available for 1B8Z) |
(no "SAP(SNP)/Variant" information available for 1B8Z) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1B8Z) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:67 aligned with DBH_THEMA | P36206 from UniProtKB/Swiss-Prot Length:90 Alignment length:90 10 20 30 40 50 60 70 80 90 DBH_THEMA 1 MTKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEVRKAAARKGVNPQTRKPITIPERKVPKFKPGKALKEKVK 90 SCOP domains d1b8za_ A: HU protein SCOP domains CATH domains 1b8zA00 A:1-90 HU Protein, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1b8z A 1 MNKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEV-----------------------VPKFKPGKALKEKVK 90 10 20 30 40 50 | - - | 80 90 52 76 Chain B from PDB Type:PROTEIN Length:67 aligned with DBH_THEMA | P36206 from UniProtKB/Swiss-Prot Length:90 Alignment length:90 10 20 30 40 50 60 70 80 90 DBH_THEMA 1 MTKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEVRKAAARKGVNPQTRKPITIPERKVPKFKPGKALKEKVK 90 SCOP domains d1b8zb_ B: HU protein SCOP domains CATH domains 1b8zB00 B:1-90 HU Protein, subunit A CATH domains Pfam domains ------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------------------------------HISTONE_LIKE ------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------ Transcript 1b8z B 1 MNKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEV-----------------------VPKFKPGKALKEKVK 90 10 20 30 40 50 | - - | 80 90 52 76
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
(no "Pfam Domain" information available for 1B8Z) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (DBH_THEMA | P36206)
|
|
|
|
|
|
|