|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1B67) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1B67) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1B67) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1B67) |
Exons (0, 0)| (no "Exon" information available for 1B67) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:68 aligned with HMFA_METFE | P48781 from UniProtKB/Swiss-Prot Length:69 Alignment length:68 11 21 31 41 51 61 HMFA_METFE 2 GELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK 69 SCOP domains d1b67a_ A: Archaeal histone SCOP domains CATH domains 1b67A00 A:2-69 Histone, subunit A CATH domains Pfam domains -------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 1b67 A 2 GELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK 69 11 21 31 41 51 61 Chain B from PDB Type:PROTEIN Length:65 aligned with HMFA_METFE | P48781 from UniProtKB/Swiss-Prot Length:69 Alignment length:65 12 22 32 42 52 62 HMFA_METFE 3 ELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKM 67 SCOP domains d1b67b_ B: Archaeal histone SCOP domains CATH domains 1b67B00 B:103-167 Histone, subunit A CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 1b67 B 103 ELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKM 167 112 122 132 142 152 162
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1B67) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (HMFA_METFE | P48781)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|