Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HIGH-RESOLUTION SOLUTION NMR STRUCTURE OF THE TRIMERIC COILED-COIL DOMAIN OF CHICKEN CARTILAGE MATRIX PROTEIN, 20 STRUCTURES
 
Authors :  S. A. Dames, R. Wiltscheck, R. A. Kammerer, J. Engel, A. T. Alexandrescu
Date :  07 Aug 97  (Deposition) - 11 Feb 98  (Release) - 03 Nov 10  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C  (20x)
NMR Structure *:  A,B,C  (1x)
Keywords :  Coiled-Coil, Heptad Repeat, Interchain Disulfide Bonds, Oligomerization Domain, Trimer, Cartilage Matrix Protein, Matrilin- 1, Noncollagenous Extracellular Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. A. Dames, R. A. Kammerer, R. Wiltscheck, J. Engel, A. T. Alexandresc
Nmr Structure Of A Parallel Homotrimeric Coiled Coil.
Nat. Struct. Biol. V. 5 687 1998
PubMed-ID: 9699631  |  Reference-DOI: 10.1038/1382
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CARTILAGE MATRIX PROTEIN
    Cell Line: BL21
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: BL21
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: CMPCC, COILED-COIL OLIGOMERIZATION DOMAIN, RESIDUES 451 - 493
    Gene: CMP
    Mutation: YES
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031
    Other Details: INTERCHAIN DISULFIDE BONDS:
    Synonym: MATRILIN-1, CMP
    Tissue: CARTILAGE MATRIX

 Structural Features

(-) Chains, Units

  123
NMR Structure (20x): ABC
NMR Structure * (1x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AQ5)

(-) Sites  (0, 0)

(no "Site" information available for 1AQ5)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:9 -C:11
2A:11 -B:9
3B:11 -C:9

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1AQ5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AQ5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AQ5)

(-) Exons   (0, 0)

(no "Exon" information available for 1AQ5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:47
 aligned with MATN1_CHICK | P05099 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:85
                                   418       428       438       448       458       468       478       488     
          MATN1_CHICK   409 GNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKICVEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII 493
               SCOP domains d                            1      aq    5a_ A: Chicken cartilage matrix protein     SCOP domains
               CATH domains 1                            a      q5    A00 A:1-47                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .----------------------------.------..----........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1aq5 A   1 G----------------------------S------HM----EEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII  47
                            |        -         -         2      || -  |     12        22        32        42     
                            |                            2      3|    5                                          
                            1                                    4                                               


Chain B from PDB  Type:PROTEIN  Length:47
 aligned with MATN1_CHICK | P05099 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:85
                                   418       428       438       448       458       468       478       488     
          MATN1_CHICK   409 GNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKICVEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII 493
               SCOP domains d                            1      aq    5b_ B: Chicken cartilage matrix protein     SCOP domains
               CATH domains 1                            a      q5    B00 B:1-47                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .----------------------------.------..----........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1aq5 B   1 G----------------------------S------HM----EEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII  47
                            |        -         -         2      || -  |     12        22        32        42     
                            1                            2      3|    5                                          
                                                                 4                                               


Chain C from PDB  Type:PROTEIN  Length:47
 aligned with MATN1_CHICK | P05099 from UniProtKB/Swiss-Prot  Length:493

    Alignment length:85
                                   418       428       438       448       458       468       478       488     
          MATN1_CHICK   409 GNAVEDELREIASEPVAEHYFYTADFRTISNIGKKLQMKICVEEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII 493
               SCOP domains d                            1      aq    5c_ C: Chicken cartilage matrix protein     SCOP domains
               CATH domains 1                            a      q5    C00 C:1-47                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .----------------------------.------..----........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------- Transcript
                 1aq5 C   1 G----------------------------S------HM----EEDPCECKSIVKFQTKVEELINTLQQKLEAVAKRIEALENKII  47
                            |        -         -         2      || -  |     12        22        32        42     
                            1                            2      3|    5                                          
                                                                 4
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

NMR Structure
(-)
Class: Coiled coil proteins (689)

(-) CATH Domains  (1, 3)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AQ5)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A,B,C   (MATN1_CHICK | P05099)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0005201    extracellular matrix structural constituent    The action of a molecule that contributes to the structural integrity of the extracellular matrix.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005578    proteinaceous extracellular matrix    A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aq5)
 
  Sites
(no "Sites" information available for 1aq5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1aq5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aq5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MATN1_CHICK | P05099
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MATN1_CHICK | P05099
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AQ5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AQ5)