Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF ACYLPHOSPHATASE. REFINEMENT AND STRUCTURE ANALYSIS
 
Authors :  V. Saudek, A. Pastore, G. Ramponi, R. J. P. Williams
Date :  20 Feb 91  (Deposition) - 15 Jul 92  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (5x)
Keywords :  Hydrolase(Acting On Acid Anhydrides) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Pastore, V. Saudek, G. Ramponi, R. J. Williams
Three-Dimensional Structure Of Acylphosphatase. Refinement And Structure Analysis.
J. Mol. Biol. V. 224 427 1992
PubMed-ID: 1313885  |  Reference-DOI: 10.1016/0022-2836(92)91005-A
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ACYLPHOSPHATASE
    Chains: A
    EC Number: 3.6.1.7
    Engineered: YES
    Organism Common: HORSE
    Organism Scientific: EQUUS CABALLUS
    Organism Taxid: 9796

 Structural Features

(-) Chains, Units

  
NMR Structure (5x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1APS)

(-) Sites  (0, 0)

(no "Site" information available for 1APS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1APS)

(-) Cis Peptide Bonds  (1, 1)

NMR Structure
No.Residues
1Ser A:70 -Pro A:71

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1APS)

(-) PROSITE Motifs  (3, 3)

NMR Structure (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ACYLPHOSPHATASE_3PS51160 Acylphosphatase-like domain profile.ACYP2_HORSE9-99  1A:8-98
2ACYLPHOSPHATASE_1PS00150 Acylphosphatase signature 1.ACYP2_HORSE14-24  1A:13-23
3ACYLPHOSPHATASE_2PS00151 Acylphosphatase signature 2.ACYP2_HORSE38-54  1A:37-53

(-) Exons   (0, 0)

(no "Exon" information available for 1APS)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with ACYP2_HORSE | P00818 from UniProtKB/Swiss-Prot  Length:99

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
           ACYP2_HORSE    2 STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY 99
               SCOP domains d1apsa_ A: Acylphosphatase                                                                         SCOP domains
               CATH domains 1apsA00 A:1-98  [code=3.30.70.100, no name defined]                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeee........hhhhhhhhhhhh..eeeeeee...eeeeeeee.hhhhhhhhhhh...........eeeeeeeee.......eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------ACYLPHOSPHATASE_3  PDB: A:8-98 UniProt: 9-99                                                PROSITE (1)
                PROSITE (2) ------------ACYLPHOSPHA-------------ACYLPHOSPHATASE_2--------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  1aps A  1 STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY 98
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1APS)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (ACYP2_HORSE | P00818)
molecular function
    GO:0003998    acylphosphatase activity    Catalysis of the reaction: an acyl phosphate + H2O = a carboxylate + phosphate.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
cellular component
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1aps)
 
  Sites
(no "Sites" information available for 1aps)
 
  Cis Peptide Bonds
    Ser A:70 - Pro A:71   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aps
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACYP2_HORSE | P00818
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ACYP2_HORSE | P00818
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1APS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1APS)