Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  JAPANESE HORSESHOE CRAB COAGULOGEN
 
Authors :  A. Bergner, V. Oganessyan, T. Muta, S. Iwanaga, D. Typke, R. Huber, W. Bode
Date :  28 Nov 96  (Deposition) - 21 Apr 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Coagulation Factor, Clottable Protein, Cystine Knot Superfamily (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Bergner, V. Oganessyan, T. Muta, S. Iwanaga, D. Typke, R. Huber, W. Bode
Crystal Structure Of A Coagulogen, The Clotting Protein From Horseshoe Crab: A Structural Homologue Of Nerve Growth Factor.
Embo J. V. 15 6789 1996
PubMed-ID: 9003754
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COAGULOGEN
    Chains: A, B
    Organism Scientific: TACHYPLEUS TRIDENTATUS
    Organism Taxid: 6853

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:91 , ARG A:128 , HOH A:196 , HOH A:210 , ARG B:66 , ARG B:119 , HOH B:617 , HOH B:686BINDING SITE FOR RESIDUE SO4 B 600

(-) SS Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1A:8 -A:167
2A:10 -A:95
3A:60 -A:161
4A:65 -A:121
5A:75 -A:168
6A:88 -A:140
7A:127 -A:170
8A:134 -A:172
9B:8 -B:167
10B:10 -B:95
11B:60 -B:161
12B:65 -B:121
13B:75 -B:168
14B:88 -B:140
15B:127 -B:170
16B:134 -B:172

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Pro A:79 -Pro A:80
2Pro B:79 -Pro B:80

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric/Biological Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_COAG_TACTR_001 *T102ICOAG_TACTR  ---  ---A/BT82I
2UniProtVAR_COAG_TACTR_002 *L106SCOAG_TACTR  ---  ---A/BS86S
   * ID not provided by source
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AOC)

(-) Exons   (0, 0)

(no "Exon" information available for 1AOC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:175
 aligned with COAG_TACTR | P02681 from UniProtKB/Swiss-Prot  Length:195

    Alignment length:175
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     
           COAG_TACTR    21 ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKLECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF 195
               SCOP domains d1aoca_ A: Coagulogen                                                                                                                                                           SCOP domains
               CATH domains 1aocA00 A:1-175 Cystine-knot cytokines                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhh........hhh....hhhhhh.........hhhh.hhh............eeee.....eee.....eee..............eeee...........eeeeeeeeeeeeeee....eeeeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------I---S----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aoc A   1 ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKSECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF 175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     


Chain B from PDB  Type:PROTEIN  Length:175
 aligned with COAG_TACTR | P02681 from UniProtKB/Swiss-Prot  Length:195

    Alignment length:175
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     
           COAG_TACTR    21 ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKLECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF 195
               SCOP domains d1aocb_ B: Coagulogen                                                                                                                                                           SCOP domains
               CATH domains 1aocB00 B:1-175 Cystine-knot cytokines                                                                                                                                          CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhh........hhhh.hhhhhh.........hhhh.hhh............eeee.....eee.....eee....hhh.......eeee............eeeeeeeeeeeeee....eeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------I---S----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aoc B   1 ADTNAPICLCDEPGVLGRTQIVTTEIKDKIEKAVEAVAQESGVSGRGFSIFSHHPVFRECGKYECRTVRPEHSRCYNFPPFTHFKSECPVSTRDCEPVFGYTVAGEFRVIVQAPRAGFRQCVWQHKCRFGSNSCGYNGRCTQQRSVVRLVTYNLEKDGFLCESFRTCCGCPCRSF 175
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AOC)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (COAG_TACTR | P02681)
biological process
    GO:0042381    hemolymph coagulation    Any process in which factors in the hemolymph (the invertebrate equivalent of vertebrate blood and lymph) precipitate into insoluble clots in order to prevent loss of body fluid, and at the same time prevent the movement of microbes. Hemolymph coagulation is also part of the invertebrate humoral immune response.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:79 - Pro A:80   [ RasMol ]  
    Pro B:79 - Pro B:80   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1aoc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  COAG_TACTR | P02681
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  COAG_TACTR | P02681
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AOC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AOC)