Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  A MODELING STUDY OF THE ALPHA-SUBUNIT OF THE HUMAN HIGH-AFFINITY RECEPTOR FOR IMMUNOGLOBULIN-E
 
Authors :  E. A. Padlan, B. A. Helm
Date :  29 Dec 94  (Deposition) - 27 Feb 95  (Release) - 01 Apr 03  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Immunoglobulin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. A. Padlan, B. A. Helm
A Modeling Study Of The Alpha-Subunit Of Human High-Affinity Receptor For Immunoglobulin-E.
Receptor V. 2 129 1992
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IGE FC RECEPTOR (ALPHA SUBUNIT)
    ChainsA
    EngineeredYES

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ALT)

(-) Sites  (0, 0)

(no "Site" information available for 1ALT)

(-) SS Bonds  (2, 2)

Theoretical Model
No.Residues
1A:26 -A:68
2A:107 -A:151

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ALT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 2)

Theoretical Model (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020091K84RFCERA_HUMANPolymorphism2298804AK59R
2UniProtVAR_020092S101NFCERA_HUMANPolymorphism2298805AS76N

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ALT)

(-) Exons   (4, 4)

Theoretical Model (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003681151ENSE00001277214chr1:159259504-15925954340FCERA_HUMAN-00--
1.2aENST000003681152aENSE00001277230chr1:159272096-159272209114FCERA_HUMAN1-19190--
1.3ENST000003681153ENSE00001067917chr1:159272644-15927266421FCERA_HUMAN19-2681A:1-11
1.4aENST000003681154aENSE00001067919chr1:159273718-159273972255FCERA_HUMAN26-111861A:1-8686
1.5ENST000003681155ENSE00001277186chr1:159275778-159276035258FCERA_HUMAN111-197871A:86-17287
1.6bENST000003681156bENSE00001446352chr1:159277538-159278014477FCERA_HUMAN197-257611A:172-1721

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:172
 aligned with FCERA_HUMAN | P12319 from UniProtKB/Swiss-Prot  Length:257

    Alignment length:172
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195  
          FCERA_HUMAN    26 VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKA 197
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeee...hhhhh....eeeeeee......eeeeee..eee.....eee..hhhhhh...eeeeee.hhh...eeee......eee...hhhhh...eeeeee.........eeehhh............eee.hhhhhh.....eee................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------R----------------N------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1------------------------------------------------------------------------------------Exon 1.5  PDB: A:86-172 UniProt: 111-197                                                Transcript 1 (1)
           Transcript 1 (2) Exon 1.4a  PDB: A:1-86 UniProt: 26-111                                                -------------------------------------------------------------------------------------1 Transcript 1 (2)
                 1alt A   1 VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKA 172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1ALT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1ALT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1ALT)

(-) Gene Ontology  (22, 22)

Theoretical Model(hide GO term definitions)
Chain A   (FCERA_HUMAN | P12319)
molecular function
    GO:0019863    IgE binding    Interacting selectively and non-covalently with an immunoglobulin of the IgE isotype.
    GO:0019767    IgE receptor activity    Combining with an immunoglobulin of the IgE isotype via the Fc region, and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
biological process
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0007257    activation of JUN kinase activity    The initiation of the activity of the inactive enzyme JUN kinase (JNK).
    GO:0000187    activation of MAPK activity    The initiation of the activity of the inactive enzyme MAP kinase (MAPK).
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0019370    leukotriene biosynthetic process    The chemical reactions and pathways resulting in the formation of leukotriene, a pharmacologically active substance derived from a polyunsaturated fatty acid, such as arachidonic acid.
    GO:0050850    positive regulation of calcium-mediated signaling    Any process that activates or increases the frequency, rate or extent of calcium-mediated signaling.
    GO:0045425    positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of granulocyte macrophage colony-stimulating factor.
    GO:0045401    positive regulation of interleukin-3 biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interleukin-3.
    GO:0043306    positive regulation of mast cell degranulation    Any process that activates or increases the frequency, rate or extent of mast cell degranulation.
    GO:0050731    positive regulation of peptidyl-tyrosine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
    GO:0001812    positive regulation of type I hypersensitivity    Any process that activates or increases the frequency, rate or extent of type I hypersensitivity, a type of inflammatory response.
    GO:0001820    serotonin secretion    The regulated release of serotonin by a cell. Serotonin (5-hydroxytryptamine, or 5-HT) is a monoamine synthesised in serotonergic neurons in the central nervous system, enterochromaffin cells in the gastrointestinal tract and some immune system cells.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1alt)
 
  Sites
(no "Sites" information available for 1alt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1alt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Midas
  ribbon, secondary structure
  spacefill, secondary structure
Setor
  ribbon, secondary structure, SS-bonds, labeling
  ribbon, secondary structure, SS-bonds, labeling, different view
  ribbon, secondary structure, SS-bonds, labeling, sticks
  spacefill
Distance Plot
  representative atom: CA

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1alt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FCERA_HUMAN | P12319
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FCERA_HUMAN | P12319
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FCERA_HUMAN | P123191als 1f2q 1f6a 1j86 1j87 1j88 1j89 1rpq 2y7q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1ALT)