1AJ8 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CITRATE SYNTHASE FROM PYROCOCCUS FURIOSUS

Authors :   R. J. M. Russell, J. M. C. Ferguson, D. W. Hough, M. J. Danson, G. L. Taylor

Date :   16 May 97 (Deposition) - 19 Nov 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Hyperthermostable, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. J. Russell, J. M. Ferguson, D. W. Hough, M. J. Danson, G. L. Taylor
The Crystal Structure Of Citrate Synthase From The Hyperthermophilic Archaeon Pyrococcus Furiosus At 1. 9 A Resolution, .
Biochemistry V. 36 9983 1997
PubMed-ID: 9254593 | Reference-DOI: 10.1021/BI9705321
(for further references see the PDB file header)

Molecule 1 - CITRATE SYNTHASE
	Chains	:	A, B
	EC Number	:	4.1.3.7
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	PYROCOCCUS FURIOSUS
	Organism Taxid	:	2261

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 4)

No.	Name	Count	Type	Full Name
1	CIT	2	Ligand/Ion	CITRIC ACID
2	COA	2	Ligand/Ion	COENZYME A

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:222 , HIS A:223 , ALA A:226 , LYS A:254 , LYS A:256 , ILE A:257 , MET A:258 , GLY A:259 , ALA A:260 , GLY A:261 , HIS A:262 , ARG A:263 , LYS A:305 , ILE A:307 , ASN A:310 , CIT A:1000 , HOH A:3132 , HOH A:3166 , HOH A:3194 , ARG B:353 , HOH B:4024	BINDING SITE FOR RESIDUE COA A 3000
2	AC2	SOFTWARE	ARG A:353 , ILE B:222 , HIS B:223 , ALA B:226 , LYS B:256 , ILE B:257 , MET B:258 , GLY B:259 , ALA B:260 , GLY B:261 , ARG B:263 , LYS B:305 , ILE B:307 , ASN B:310 , CIT B:2000 , HOH B:4005 , HOH B:4012 , HOH B:4110 , HOH B:4233	BINDING SITE FOR RESIDUE COA B 4000
3	AC3	SOFTWARE	HIS A:188 , ASN A:191 , HIS A:223 , GLY A:224 , HIS A:262 , ARG A:271 , ASP A:312 , ARG A:337 , COA A:3000 , HOH A:3025 , HOH A:3035 , HOH A:3194 , ARG B:356	BINDING SITE FOR RESIDUE CIT A 1000
4	AC4	SOFTWARE	ARG A:356 , HIS B:188 , ASN B:191 , HIS B:223 , GLY B:224 , HIS B:262 , ARG B:271 , ASP B:312 , ARG B:337 , COA B:4000 , HOH B:4041 , HOH B:4110 , HOH B:4142	BINDING SITE FOR RESIDUE CIT B 2000
5	ACA	UNKNOWN	HIS A:223 , HIS A:262 , ASP A:312	CATALYTIC RESIDUES.
6	ACB	UNKNOWN	HIS B:223 , HIS B:262 , ASP B:312	CATALYTIC RESIDUES.

(no "SS Bond" information available for 1AJ8)

(no "Cis Peptide Bond" information available for 1AJ8)

(no "SAP(SNP)/Variant" information available for 1AJ8)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CITRATE_SYNTHASE	PS00480	Citrate synthase signature.	CISY_PYRFU	260-272	2	A:259-271 B:259-271

(no "Exon" information available for 1AJ8)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:371
 aligned with CISY_PYRFU | Q53554 from UniProtKB/Swiss-Prot  Length:377

    Alignment length:371
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376 
           CISY_PYRFU     7 LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELSTFEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIEIMEALPKNTHPMGALRTIISYLGNIDDSGDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPKEKLSHAANFLYMLHGEEPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQFMEIGSPEKVEEWFFKALQQKRKIMGAGHRVYKTYDPRARIFKKYASKLGDKKLFEIAERLERLVEEYLSKKGISINVDYWSGLVFYGMKIPIELYTTIFAMGRIAGWTAHLAEYVSHNRIIRPRLQYVGEIGKKYLPIELRR 377
               SCOP domains d1aj8a_ A: Citrate synthase                                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains ----------1aj8A01 A:16-224,A:323-355 Citrate Synthase, domain 1                                                                                                                                                            1aj8A02 A:225-322 Cytochrome P450-Terp, domain 2                                                  1aj8A01 A:16-224,A:323-355       --------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh..........eeee....eeee....hhhhhhh..hhhhhhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhh.....hhhhhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh................hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.............hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh....................hhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH--------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aj8 A   6 LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELSTFEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIEIMEALPKNTHPMGALRTIISYLGNIDDSGDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPKEKLSHAANFLYMLHGEEPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQFMEIGSPEKVEEWFFKALQQKRKIMGAGHRVYKTYDPRARIFKKYASKLGDKKLFEIAERLERLVEEYLSKKGISINVDYWSGLVFYGMKIPIELYTTIFAMGRIAGWTAHLAEYVSHNRIIRPRLQYVGEIGKKYLPIELRR 376
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375

Chain B from PDB  Type:PROTEIN  Length:370
 aligned with CISY_PYRFU | Q53554 from UniProtKB/Swiss-Prot  Length:377

    Alignment length:370
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376
           CISY_PYRFU     7 LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELSTFEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIEIMEALPKNTHPMGALRTIISYLGNIDDSGDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPKEKLSHAANFLYMLHGEEPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQFMEIGSPEKVEEWFFKALQQKRKIMGAGHRVYKTYDPRARIFKKYASKLGDKKLFEIAERLERLVEEYLSKKGISINVDYWSGLVFYGMKIPIELYTTIFAMGRIAGWTAHLAEYVSHNRIIRPRLQYVGEIGKKYLPIELR 376
               SCOP domains d1aj8b_ B: Citrate synthase                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains ----------1aj8B01 B:16-224,B:323-355 Citrate Synthase, domain 1                                                                                                                                                            1aj8B02 B:225-322 Cytochrome P450-Terp, domain 2                                                  1aj8B01 B:16-224,B:323-355       -------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeee....eeee....hhhhhhh..hhhhhhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhh.....hhhhhhhhhhhhhh......hhhhhhhhhhhh...hhhhhhhhhhhh.....hhhhhhhhhhhhhh.....hhhhhhhhhh.................hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.hhh.........hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH-------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1aj8 B   6 LAKGLEDVYIDQTNICYIDGKEGKLYYRGYSVEELAELSTFEEVVYLLWWGKLPSLSELENFKKELAKSRGLPKEVIEIMEALPKNTHPMGALRTIISYLGNIDDSGDIPVTPEEVYRIGISVTAKIPTIVANWYRIKNGLEYVPPKEKLSHAANFLYMLHGEEPPKEWEKAMDVALILYAEHEINASTLAVMTVGSTLSDYYSAILAGIGALKGPIHGGAVEEAIKQFMEIGSPEKVEEWFFKALQQKRKIMGAGHRVYKTYDPRARIFKKYASKLGDKKLFEIAERLERLVEEYLSKKGISINVDYWSGLVFYGMKIPIELYTTIFAMGRIAGWTAHLAEYVSHNRIIRPRLQYVGEIGKKYLPIELR 375
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Citrate synthase (43)

Superfamily: Citrate synthase (43)

Family: Citrate synthase (38)

Protein domain: Citrate synthase (32)

Pyrococcus furiosus [TaxId: 2261] (1)

1a	d1aj8a_	A:
1b	d1aj8b_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Citrate Synthase; domain 1 (32)

Homologous Superfamily: Citrate Synthase, domain 1 (32)

Pyrococcus furiosus. Organism_taxid: 2261. (1)

1a	1aj8A01	A:16-224,A:323-355
1b	1aj8B01	B:16-224,B:323-355

Topology: Cytochrome p450-Terp; domain 2 (32)

Homologous Superfamily: Cytochrome P450-Terp, domain 2 (32)

Pyrococcus furiosus. Organism_taxid: 2261. (1)

2a	1aj8A02	A:225-322
2b	1aj8B02	B:225-322

(no "Pfam Domain" information available for 1AJ8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CISY_PYRFU | Q53554)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0046912	transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor), with the acyl group being converted into alkyl on transfer.
biological process
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		ACA	[ RasMol ]	+environment [ RasMol ]
		ACB	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1aj8)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1aj8
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CISY_PYRFU \| Q53554
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.1.3.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CISY_PYRFU \| Q53554
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1AJ8)

(no "Related Entries Specified in the PDB File" available for 1AJ8)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File