Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE ANTIFUNGAL PROTEIN FROM ASPERGILLUS GIGANTEUS. EVIDENCE FOR DISULPHIDE CONFIGURATIONAL ISOMERISM
 
Authors :  R. Campos-Olivas, M. Bruix, J. Santoro, J. Lacadena, A. M. Del Pozo, J. G. Gavilanes, M. Rico
Date :  11 Nov 94  (Deposition) - 07 Feb 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (40x)
Keywords :  Antifungal Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Campos-Olivas, M. Bruix, J. Santoro, J. Lacadena, A. Martinez Del Pozo, J. G. Gavilanes, M. Rico
Nmr Solution Structure Of The Antifungal Protein From Aspergillus Giganteus: Evidence For Cysteine Pairing Isomerism.
Biochemistry V. 34 3009 1995
PubMed-ID: 7893713  |  Reference-DOI: 10.1021/BI00009A032
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ANTIFUNGAL PROTEIN FROM ASPERGILLUS GIGANTEUS
    Chains: A
    Engineered: YES
    Organism Scientific: ASPERGILLUS GIGANTEUS
    Organism Taxid: 5060

 Structural Features

(-) Chains, Units

  
NMR Structure (40x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1AFP)

(-) Sites  (0, 0)

(no "Site" information available for 1AFP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1AFP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1AFP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1AFP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1AFP)

(-) Exons   (0, 0)

(no "Exon" information available for 1AFP)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:51
 aligned with AFP_ASPGI | P17737 from UniProtKB/Swiss-Prot  Length:94

    Alignment length:51
                                    53        63        73        83        93 
             AFP_ASPGI   44 ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC 94
               SCOP domains d1afpa_ A: Antifungal protein (AGAFP)               SCOP domains
               CATH domains 1afpA00 A:1-51  [code=2.40.50.60, no name defined]  CATH domains
               Pfam domains --------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeee.......eeee..........eeeeee....eeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------- Transcript
                  1afp A  1 ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC 51
                                    10        20        30        40        50
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1AFP)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (AFP_ASPGI | P17737)
biological process
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1afp)
 
  Sites
(no "Sites" information available for 1afp)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1afp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1afp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AFP_ASPGI | P17737
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AFP_ASPGI | P17737
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1AFP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1AFP)