|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1AC6) |
Sites (0, 0)| (no "Site" information available for 1AC6) |
SS Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1AC6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1AC6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1AC6) |
Exons (0, 0)| (no "Exon" information available for 1AC6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with Q5R1F5_MOUSE | Q5R1F5 from UniProtKB/TrEMBL Length:112 Alignment length:110 112 30 40 50 60 70 80 90 100 110 | - - Q5R1F5_MOUSE 21 DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS------------------ - SCOP domains d1ac6a_ A: T-cell antigen receptor SCOP domains CATH domains 1ac6A00 A:1-112 Immunoglobulins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1ac6 A 1 DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSGGNNKLTFGAGTKLTIKP 112 10 20 30 40 50 60 70 80 90 || 102 112 93| 96 Chain B from PDB Type:PROTEIN Length:110 aligned with Q5R1F5_MOUSE | Q5R1F5 from UniProtKB/TrEMBL Length:112 Alignment length:110 112 30 40 50 60 70 80 90 100 110 | - - Q5R1F5_MOUSE 21 DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS------------------ - SCOP domains d1ac6b_ B: T-cell antigen receptor SCOP domains CATH domains 1ac6B00 B:1-112 Immunoglobulins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1ac6 B 1 DSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALSGGNNKLTFGAGTKLTIKP 112 10 20 30 40 50 60 70 80 90 || 102 112 93| 96
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1AC6) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1AC6)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||||||||||||||||||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|