|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (4, 4)
NMR Structure (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1A7I) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1A7I) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1A7I) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1A7I) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:60 aligned with CSRP2_COTJA | Q05158 from UniProtKB/Swiss-Prot Length:194 Alignment length:60 17 27 37 47 57 67 CSRP2_COTJA 8 NKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDAEVYCKSCYGKKYG 67 SCOP domains d1a7ia1 A:8-35 d1a7ia2 A:36-67 SCOP domains CATH domains 1a7iA00 A:8-67 Cysteine Rich Protein CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE (1) LIM_DOMAIN_2 PDB: A:8-67 UniProt: 8-68 PROSITE (1) PROSITE (2) --LIM_DOMAIN_1 PDB: A:10-44 ----------------------- PROSITE (2) Transcript ------------------------------------------------------------ Transcript 1a7i A 8 NKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDAEVYCKSCYGKKYG 67 17 27 37 47 57 67
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1A7I) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (CSRP2_COTJA | Q05158)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|