Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with SGF29_HUMAN | Q96ES7 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:186
                                   111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281      
          SGF29_HUMAN   102 GLYNDSEPPRKTMRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC 287
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ----                          ---     -----------------DUF1325-3l       x7A01 A:157-287                                                                                                    Pfam domains
         Sec.struct. author ....--------------------------...-----.....................eeee..-------.eeeeeeeeee....eeeeee.-----.eeeee...eee..........hhhhh.....eeeee.....eeeeeeeee........eeeee............eeehhh.eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------SGF29_C  PDB: A:152-287 UniProt: 152-293                                                                                                 PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3LX7 A 129 GREN--------------------------LYF-----KPPPLCGAIPASGDYVARPGDKVAARV-------QWILAEVVSYSHATNKYEVDDI-----ERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC 287
                               |     -         -         -| |    141       151       161    |    -  |    181       191   |   201       211       221       231       241       251       261       271       281      
                             132                        133 |   140                       166     174                  195   201                                                                                      
                                                          135                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'