Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:207
 aligned with Q2GKX4_ANAPZ | Q2GKX4 from UniProtKB/TrEMBL  Length:206

    Alignment length:207
                             1                                                                                                                                                                                                             
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       
         Q2GKX4_ANAPZ     - -MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
               SCOP domains d3js4a1 A:0-89 automated matches                                                          d3js4a2 A:90-206 automated matches                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3JS4 A   0 SMFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       

Chain B from PDB  Type:PROTEIN  Length:207
 aligned with Q2GKX4_ANAPZ | Q2GKX4 from UniProtKB/TrEMBL  Length:206

    Alignment length:207
                             1                                                                                                                                                                                                             
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       
         Q2GKX4_ANAPZ     - -MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
               SCOP domains d3js4b1 B:0-89 automated matches                                                          d3js4b2 B:90-206 automated matches                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .................hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3JS4 B   0 SMFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       

Chain C from PDB  Type:PROTEIN  Length:206
 aligned with Q2GKX4_ANAPZ | Q2GKX4 from UniProtKB/TrEMBL  Length:206

    Alignment length:206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200      
         Q2GKX4_ANAPZ     1 MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
               SCOP domains d3js4c1 C:1-89 automated matches                                                         d3js4c2 C:90-206 automated matches                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3JS4 C   1 MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200      

Chain D from PDB  Type:PROTEIN  Length:206
 aligned with Q2GKX4_ANAPZ | Q2GKX4 from UniProtKB/TrEMBL  Length:206

    Alignment length:206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200      
         Q2GKX4_ANAPZ     1 MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
               SCOP domains d3js4d1 D:1-89 automated matches                                                         d3js4d2 D:90-206 automated matches                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Sod_Fe_N-3js4D05 D:1-88                                                                 ----Sod_Fe_C-3js4D01 D:93-200                                                                                   ------ Pfam domains (1)
           Pfam domains (2) Sod_Fe_N-3js4D06 D:1-88                                                                 ----Sod_Fe_C-3js4D02 D:93-200                                                                                   ------ Pfam domains (2)
           Pfam domains (3) Sod_Fe_N-3js4D07 D:1-88                                                                 ----Sod_Fe_C-3js4D03 D:93-200                                                                                   ------ Pfam domains (3)
           Pfam domains (4) Sod_Fe_N-3js4D08 D:1-88                                                                 ----Sod_Fe_C-3js4D04 D:93-200                                                                                   ------ Pfam domains (4)
         Sec.struct. author ................hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....eeeeeeee...hhhhh..eeeeeeee.hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3JS4 D   1 MFELSDLPYEGLEPYISSHLLDRHYNGHHKTYVDVLNKLVVGTEFEGLGNESLGDIVVKAHNSGSAGRAIFNNAAQIWNHDFYWQSMKPNGGGNPPEKLREMIEHSFGSVEGFNNAFTTSGLGQFGSGWVWLVYDEDAKALKVVSTANADSPLLTQGQLPLATMDVWEHAYYLDYLNLRKKYIDVFLEHLLNWDFVLGRLEDAGVL 206
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'