Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:173
 aligned with Q9S1N8_STRCO | Q9S1N8 from UniProtKB/TrEMBL  Length:190

    Alignment length:188
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182        
         Q9S1N8_STRCO     3 KMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAETGAGDTADLPADVPEIDHESAFEAGLALITDGLVRHVDAR 190
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3fiwA01 A:3-58 Homeodomain-like                         ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh---------------.hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3FIW A   3 KmNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAmAQAAmAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKmDFLVASGVPERHAQmAmLAAGRFTVGCVLEEQAE---------------IDHESAFEAGLALITDGLVRHVDAR 190
                             |      12        22        32        42        52  |    |62        72        82        92       102       112   |   122       132|      142       | -         -   |   172       182        
                             |                                                 55-MSE|                                                     116-MSE        131-MSE            150             166                        
                             4-MSE                                                  60-MSE                                                                  133-MSE                                                     

Chain B from PDB  Type:PROTEIN  Length:167
 aligned with Q9S1N8_STRCO | Q9S1N8 from UniProtKB/TrEMBL  Length:190

    Alignment length:184
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183    
         Q9S1N8_STRCO     4 MNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAETGAGDTADLPADVPEIDHESAFEAGLALITDGLVRHV 187
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -3fiwB01 B:5-58 Homeodomain-like                       --------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.hhhhhhhh...--hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh---------------.hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3FIW B   4 mNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAmAQAAmAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRP--DLDRVRRKmDFLVASGVPERHAQmAmLAAGRFTVGCVLEEQAE---------------IDHESAFEAGLALITDGLVRHV 187
                            |       13        23        33        43        53 |    | 63        73        83        93       103 |  |  113  |    123       133       143      |  -         -  |    173       183    
                            4-MSE                                             55-MSE|                                          105  |     116-MSE        131-MSE            150             166                     
                                                                                   60-MSE                                         108                      133-MSE                                                  

Chain C from PDB  Type:PROTEIN  Length:173
 aligned with Q9S1N8_STRCO | Q9S1N8 from UniProtKB/TrEMBL  Length:190

    Alignment length:189
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181         
         Q9S1N8_STRCO     2 TKMNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAETGAGDTADLPADVPEIDHESAFEAGLALITDGLVRHVDAR 190
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3fiwC01 C:2-58 Homeodomain-like                          ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..hhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh----------------hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3FIW C   2 TKmNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAmAQAAmAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKmDFLVASGVPERHAQmAmLAAGRFTVGCVLEEQAE----------------DHESAFEAGLALITDGLVRHVDAR 190
                              |     11        21        31        41        51   |    61        71        81        91       101       111    |  121       131 |     141        |-         -     | 171       181         
                              4-MSE                                             55-MSE|                                                     116-MSE        131-MSE            150              167                       
                                                                                     60-MSE                                                                  133-MSE                                                     

Chain D from PDB  Type:PROTEIN  Length:169
 aligned with Q9S1N8_STRCO | Q9S1N8 from UniProtKB/TrEMBL  Length:190

    Alignment length:184
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184    
         Q9S1N8_STRCO     5 NRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAMAQAAMAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKMDFLVASGVPERHAQMAMLAAGRFTVGCVLEEQAETGAGDTADLPADVPEIDHESAFEAGLALITDGLVRHVD 188
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3fiwD01 D:5-58 Homeodomain-like                       ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh---------------.hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3FIW D   5 NRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTAmAQAAmAPHAAEPLPEPGEDWHGWFLRNTRSFRRTLLARRDGARLHAGSRPTADLDRVRRKmDFLVASGVPERHAQmAmLAAGRFTVGCVLEEQAE---------------IDHESAFEAGLALITDGLVRHVD 188
                                    14        24        34        44        54|    |  64        74        84        94       104       114 |     124      |134       144     |   -         - |     174       184    
                                                                             55-MSE|                                                     116-MSE        131-MSE            150             166                      
                                                                                  60-MSE                                                                  133-MSE                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'