Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:173
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:173
                                   1                                                                                                                                                                     
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
           FTN_HELPJ      - -------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
               SCOP domains d3bvea_ A: automated matches                                                                                                                                                  SCOP domains
               CATH domains 3bveA00 A:1006-166  [code=1.20.1260.10, no name defined]                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------FERRITIN_LIKE  PDB: A:1-145 UniProt: 1-145                                                                                                       --------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE A 1006 HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
                            |||||||  3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
                            |||||||                                                                                                                                                                      
                         1006||||||                                                                                                                                                                      
                          1005|||||                                                                                                                                                                      
                           1004||||                                                                                                                                                                      
                            1003|||                                                                                                                                                                      
                             1002||                                                                                                                                                                      
                              1001|                                                                                                                                                                      
                                  0                                                                                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:173
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:173
                                   1                                                                                                                                                                     
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
           FTN_HELPJ      - -------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
               SCOP domains d3bveb_ B: automated matches                                                                                                                                                  SCOP domains
               CATH domains 3bveB00 B:1006-166  [code=1.20.1260.10, no name defined]                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------FERRITIN_LIKE  PDB: B:1-145 UniProt: 1-145                                                                                                       --------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE B 1006 HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
                            |||||||  3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
                         1006||||||                                                                                                                                                                      
                          1005|||||                                                                                                                                                                      
                           1004||||                                                                                                                                                                      
                            1003|||                                                                                                                                                                      
                             1002||                                                                                                                                                                      
                              1001|                                                                                                                                                                      
                                  0                                                                                                                                                                      

Chain C from PDB  Type:PROTEIN  Length:173
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:173
                                   1                                                                                                                                                                     
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
           FTN_HELPJ      - -------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
               SCOP domains d3bvec_ C: automated matches                                                                                                                                                  SCOP domains
               CATH domains 3bveC00 C:1006-166  [code=1.20.1260.10, no name defined]                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------FERRITIN_LIKE  PDB: C:1-145 UniProt: 1-145                                                                                                       --------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE C 1006 HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
                            |||||||  3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
                         1006||||||                                                                                                                                                                      
                          1005|||||                                                                                                                                                                      
                           1004||||                                                                                                                                                                      
                            1003|||                                                                                                                                                                      
                             1002||                                                                                                                                                                      
                              1001|                                                                                                                                                                      
                                  0                                                                                                                                                                      

Chain D from PDB  Type:PROTEIN  Length:173
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:173
                                   1                                                                                                                                                                     
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
           FTN_HELPJ      - -------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
               SCOP domains d3bved_ D: automated matches                                                                                                                                                  SCOP domains
               CATH domains 3bveD00 D:1006-166  [code=1.20.1260.10, no name defined]                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------FERRITIN_LIKE  PDB: D:1-145 UniProt: 1-145                                                                                                       --------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE D 1006 HHHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
                            |||||||  3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163   
                         1006||||||                                                                                                                                                                      
                          1005|||||                                                                                                                                                                      
                           1004||||                                                                                                                                                                      
                            1003|||                                                                                                                                                                      
                             1002||                                                                                                                                                                      
                              1001|                                                                                                                                                                      
                                  0                                                                                                                                                                      

Chain E from PDB  Type:PROTEIN  Length:172
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:172
                                  1                                                                                                                                                                     
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164  
           FTN_HELPJ      - ------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
               SCOP domains d3bvee_ E: automated matches                                                                                                                                                 SCOP domains
               CATH domains 3bveE00 E:1005-166  [code=1.20.1260.10, no name defined]                                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------FERRITIN_LIKE  PDB: E:1-145 UniProt: 1-145                                                                                                       --------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE E 1005 HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK  166
                            ||||||   4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164  
                         1005|||||                                                                                                                                                                      
                          1004||||                                                                                                                                                                      
                           1003|||                                                                                                                                                                      
                            1002||                                                                                                                                                                      
                             1001|                                                                                                                                                                      
                                 0                                                                                                                                                                      

Chain F from PDB  Type:PROTEIN  Length:173
 aligned with FTN_HELPJ | Q9ZLI1 from UniProtKB/Swiss-Prot  Length:167

    Alignment length:173
                                  1                                                                                                                                                                      
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164   
           FTN_HELPJ      - ------MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS  167
               SCOP domains d3bvef_ F: automated matches                                                                                                                                                  SCOP domains
               CATH domains 3bveF00 F:1005-167  [code=1.20.1260.10, no name defined]                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------FERRITIN_LIKE  PDB: F:1-145 UniProt: 1-145                                                                                                       ---------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3BVE F 1005 HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS  167
                            ||||||   4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164   
                         1005|||||                                                                                                                                                                       
                          1004||||                                                                                                                                                                       
                           1003|||                                                                                                                                                                       
                            1002||                                                                                                                                                                       
                             1001|                                                                                                                                                                       
                                 0                                                                                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'