Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:343
 aligned with KAPCA_HUMAN | P17612 from UniProtKB/Swiss-Prot  Length:351

    Alignment length:348
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343        
          KAPCA_HUMAN     4 AAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 351
               SCOP domains d3amba_ A: cAMP-dependent PK, catalytic subunit                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eeeeeeeeee..eeeeeeee.....eeeeeeeehhhhhhh.hhhhhhhhhhhhhhh.......eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..........hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh..............hhhhhhhhhhh..hhhhhhh............-----.......................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------V----Q---------------------------------------------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------------C--------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------AGC_KINASE_CTER  PDB: A:298-350 UniProt: 299-351      PROSITE
           Transcript 1 (1) Exon 1.1     --------------------Exon 1.4  PDB: A:36-78 UniProt: 37-79      Exon 1.5  PDB: A:79-111          Exon 1.6  PDB: A:112-139    ------------------------------------------Exon 1.8  PDB: A:182-213        Exon 1.9  PDB: A:214-254 UniProt: 215-255Exon 1.10  PDB: A:255-309 UniProt: 256-310             Exon 1.11  PDB: A:310-350 (gaps)          Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.3  PDB: A:15-3-------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:139-181 UniProt: 140-182  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3AMB A   3 AAAAKKGsEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIRTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRIQQAVNFPFLVKLEFSFKDNSNLYMVLEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIKVADFGFAKRVKGRTWtLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK-----SNFDDYEEEEIRVsINEKCGKEFSEF 350
                                   |12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192    |  202       212       222       232       242       252       262       272       282       292       302       312      |  -  |    332     | 342        
                                  10-SEP                                                                                                                                                                                    197-TPO                                                                                                                   319   325          338-SEP        

Chain B from PDB  Type:PROTEIN  Length:20
 aligned with IPKA_HUMAN | P61925 from UniProtKB/Swiss-Prot  Length:76

    Alignment length:20
                                    15        25
           IPKA_HUMAN     6 TTYADFIASGRTGRRNAIHD  25
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author hhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -------------------- SAPs(SNPs)
                    PROSITE -------------------- PROSITE
               Transcript 2 Exon 2.4  PDB: B:5-2 Transcript 2
                 3AMB B   5 TTYADFIASGRTGRRNAIHD  24
                                    14        24

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'