Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:149
 aligned with GA45G_HUMAN | O95257 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:149
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150         
          GA45G_HUMAN    11 TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE 159
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhh.............eeeee........hhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------S----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2WAL A  11 TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE 159
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150         

Chain B from PDB  Type:PROTEIN  Length:136
 aligned with GA45G_HUMAN | O95257 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:149
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150         
          GA45G_HUMAN    11 TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE 159
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------Ribosomal_L7Ae-2walB01 B:24-108                                                      --------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------Ribosomal_L7Ae-2walB02 B:24-108                                                      --------------------------------------------------- Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhhhhhhh......eehhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhh...--------..eeee..-----..hhhhhhhhhhhhhhhhh.....ee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2WAL B  11 TVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVAFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAG--------LHCILISN-----WKDPALEKLSLFCEESRSVNDWVPSITLPE 159
                                    20        30        40        50        60        70        80        90       100       | -      |120   |   130       140       150         
                                                                                                                           108      117    124   130                             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'