Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:138
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:168
                                   396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546        
         KCC2G_HUMAN    387 TTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPA  554
               SCOP domains --d2ux0a1 A                             :387-521 Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A                      -- SCOP domains
               CATH domains 2ux0A00 A:3                             85-521  [code=3.10.450.50, no name defined]                                                                                   -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee..-. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2UX0 A  385 SMTEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA-G 1521
                                   394|        -         -         -|      405       415       425       435       445       455       465       475       485       495       505       515     | |
                                    395                           396                                                                                                                          521 |
                                                                                                                                                                                                1521

Chain B from PDB  Type:PROTEIN  Length:137
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:167
                                   396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       
         KCC2G_HUMAN    387 TTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAP  553
               SCOP domains d2ux0b_ B:                              automated matches                                                                                                               SCOP domains
               CATH domains 2ux0B00 B:3                             85-520  [code=3.10.450.50, no name defined]                                                                                  -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee.-. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2UX0 B  385 SMTEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSG-G 1521
                                   394|        -         -         -|      405       415       425       435       445       455       465       475       485       495       505       515    | |
                                    395                           396                                                                                                                         520 |
                                                                                                                                                                                               1521

Chain C from PDB  Type:PROTEIN  Length:138
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:168
                                   396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546        
         KCC2G_HUMAN    387 TTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPA  554
               SCOP domains d2ux0c_ C:                              automated matches                                                                                                                SCOP domains
               CATH domains 2ux0C00 C:3                             85-521  [code=3.10.450.50, no name defined]                                                                                   -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee..-. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                2UX0 C  385 SMTEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA-G 1521
                                   394|        -         -         -|      405       415       425       435       445       455       465       475       485       495       505       515     | |
                                    395                           396                                                                                                                          521 |
                                                                                                                                                                                                1521

Chain D from PDB  Type:PROTEIN  Length:137
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:167
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       
         KCC2G_HUMAN    388 TTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPA  554
               SCOP domains d2ux0d_ D:                              automated matches                                                                                                               SCOP domains
               CATH domains 2ux0D00 D:                             386-521  [code=3.10.450.50, no name defined]                                                                                  -- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee..-. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2UX0 D  386 MTEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGA-G 1521
                                   395         -         -       396       406       416       426       436       446       456       466       476       486       496       506       516    | |
                                   395                           396                                                                                                                          521 |
                                                                                                                                                                                               1521

Chain E from PDB  Type:PROTEIN  Length:136
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:166
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547      
         KCC2G_HUMAN    388 TTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAP  553
               SCOP domains d2ux0e_ E:                              automated matches                                                                                                              SCOP domains
               CATH domains 2ux0E00 E:                             386-520  [code=3.10.450.50, no name defined]                                                                                 -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee.-. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2UX0 E  386 MTEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSG-G 1521
                                   395         -         -       396       406       416       426       436       446       456       466       476       486       496       506       516   | |
                                   395                           396                                                                                                                         520 |
                                                                                                                                                                                              1521

Chain F from PDB  Type:PROTEIN  Length:134
 aligned with KCC2G_HUMAN | Q13555 from UniProtKB/Swiss-Prot  Length:558

    Alignment length:163
                                   398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548   
         KCC2G_HUMAN    389 TEDEDLKARSPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSG  551
               SCOP domains d2ux0f_ F                             : automated matches                                                                                                           SCOP domains
               CATH domains 2ux0F00 F                             :387-520  [code=3.10.450.50, no name defined]                                                                                 CATH domains
           Pfam domains (1) --------------------------------------CaMKII_AD-2ux0F01 F:396-520                                                                                                   Pfam domains (1)
           Pfam domains (2) --------------------------------------CaMKII_AD-2ux0F02 F:396-520                                                                                                   Pfam domains (2)
           Pfam domains (3) --------------------------------------CaMKII_AD-2ux0F03 F:396-520                                                                                                   Pfam domains (3)
           Pfam domains (4) --------------------------------------CaMKII_AD-2ux0F04 F:396-520                                                                                                   Pfam domains (4)
           Pfam domains (5) --------------------------------------CaMKII_AD-2ux0F05 F:396-520                                                                                                   Pfam domains (5)
           Pfam domains (6) --------------------------------------CaMKII_AD-2ux0F06 F:396-520                                                                                                   Pfam domains (6)
         Sec.struct. author .hhhhhhhh-----------------------------hhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee.hhhh..eeehhhhhhhhhhhh.......eeeeeeeeeeee....eeeeeeeeeeeee.....eeeeeeeeeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2UX0 F  387 TEDEDLKVR-----------------------------KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSG  520
                                    |-         -         -       397       407       417       427       437       447       457       467       477       487       497       507       517   
                                  395                           396                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'