Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:390
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:390
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471
           SYWC_HUMAN    82 EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ 471
               SCOP domains d2quia_ A: Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 2quiA01 A:82-339 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                            2quiA02 A:340-471 Tyrosyl-Transfer RNA Synthetase                                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhh.....eeeee...ee..eeeee....hhhhh.....hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D---------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------AA_TRNA_LIG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:82-105 -----------------------------------Exon 1.6  PDB: A:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: A:242-276           -------------------------------------Exon 1.10  PDB: A:314-371 UniProt: 314-371                Exon 1.11  PDB: A:372-418 UniProt: 372-418     Exon 1.12b  PDB: A:419-471 UniProt: 419-471           Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.5  PDB: A:105-141             ---------------------------------------Exon 1.7  PDB: A:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: A:276-313              -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2QUI A  82 EDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ 471
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471

Chain B from PDB  Type:PROTEIN  Length:379
 aligned with SYWC_HUMAN | P23381 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:379
                                                                                                                                                                                                                                                                                                                                                                                                                471    
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466    |    
           SYWC_HUMAN    97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ----   -
               SCOP domains d2quib_ B: Tryptophanyl-tRNA synthetase (TrpRS)                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 2quiB01 B:97-350 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1                                                                                                                                                                                        2quiB02 B:351-475 Tyrosyl-Transfer RNA Synthetase                                                                             CATH domains
           Pfam domains (1) ------------------------------------------------------tRNA-synt_1b-2quiB01 B:151-443                                                                                                                                                                                                                                                                       -------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------tRNA-synt_1b-2quiB02 B:151-443                                                                                                                                                                                                                                                                       -------------------------------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhh.ee.hhhhhhhhhhhhh...hhhhhh..eeeeehhhhhhhhhhh...eeeeeee.......hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhh..hhhhhhhhhhhhhhhhhh.......eeeeehhhhhh...hhhhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeee..hhhhhhhhhhhhhhhh....eeeee..........................hhhhhhhhhhhhh......hhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D-------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------AA_TRNA_LIG------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4 -----------------------------------Exon 1.6  PDB: B:141-181 UniProt: 141-181------------------------------------------------------------Exon 1.8  PDB: B:242-276           -------------------------------------Exon 1.10  PDB: B:314-371 UniProt: 314-371                Exon 1.11  PDB: B:372-418 UniProt: 372-418     Exon 1.12b  PDB: B:419-471 UniProt: 419-471          ---- Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.5  PDB: B:105-141             ---------------------------------------Exon 1.7  PDB: B:181-242 UniProt: 181-242                     ---------------------------------Exon 1.9  PDB: B:276-313              ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2QUI B  97 GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQHHHH 475
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'