Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:89
 aligned with FAS_RAT | P12785 from UniProtKB/Swiss-Prot  Length:2505

    Alignment length:89
                                  2123      2133      2143      2153      2163      2173      2183      2193         
             FAS_RAT   2114 GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDTELAAPKSKN 2202
               SCOP domains d2pnga_ A: Type I fatty acid synthase ACP domain                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------PP-binding-2pngA01 A:7-73                                          ---------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhh...........hhhhhh..hhhhhhhhhhhhhhh....hhhhhh...hhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------PHOSPHOPANTETHEI----------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------- Transcript
                2PNG A    1 GDGEAQRDLVKAVAHILGIRDLAGINLDSSLADLGLDSLMGVEVRQILEREHDLVLPIREVRQLTLRKLQEMSSKAGSDTELAAPKSKN   89
                                    10        20        30        40        50        60        70        80         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'