Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:223
 aligned with UNG_HUMAN | P13051 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:223
                                   100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310   
            UNG_HUMAN    91 PVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL 313
               SCOP domains d2oyta_ A: Uracil-DNA glycosylase                                                                                                                                                                                               SCOP domains
               CATH domains 2oytA00 A:82-304 Uracil-DNA Glycosylase, subunit E                                                                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------UDG-2oytA01 A:131-292                                                                                                                                             ------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.ee.hhhhhhhhhh..hhhhh.eeeee.......................hhhhhhhhhhhhhhh..........hhhhhhh.eeeee....ee..........hhhhhhhhhhhhhhhhh...eeeee..hhhhhhhhh.....eeeee...............hhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------S-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------U_DNA_GLYC------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2c  PDB: A:82-10Exon 1.3  PDB: A:105-136        Exon 1.4  PDB: A:137-169         -----------------------------Exon 1.6  PDB: A:199-258 UniProt: 208-267                   Exon 1.7  PDB: A:259-304 UniProt: 268-313      Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------Exon 1.5  PDB: A:169-199       --------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2OYT A  82 MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL 304
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301   

Chain B from PDB  Type:DNA  Length:9
                                         
                 2OYT B   2 TGTxATCTT  10
                               |     
                               5-AAB 

Chain C from PDB  Type:DNA  Length:10
                                          
                 2OYT C  21 AAAGATxACA  30
                                  | 30
                                 27-4MF

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'