Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:35
 aligned with SMUF1_HUMAN | Q9HCE7 from UniProtKB/Swiss-Prot  Length:757

    Alignment length:35
                                   314       324       334     
          SMUF1_HUMAN   305 LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRL 339
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ---WW-2lb1A01 A:282-311          -- Pfam domains
         Sec.struct. author .......eeeeee...eeeeee....eee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (1) -WW_DOMAIN_2  PDB: A:280-313        PROSITE (1)
                PROSITE (2) -------WW_DOMAIN_1  PDB: A:286-31-- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                 2LB1 A 279 LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRL 313
                                   288       298       308     

Chain B from PDB  Type:PROTEIN  Length:14
 aligned with SMAD1_HUMAN | Q15797 from UniProtKB/Swiss-Prot  Length:465

    Alignment length:14
                                   230    
          SMAD1_HUMAN   221 DTPPPAYLPPEDPM 234
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author .............. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
               Transcript 1 Exon 1.11      Transcript 1
                 2LB1 B 221 DTPPPAYLPPEDPx 234
                                   230   |
                                       234-NH2

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'