Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:262
 aligned with ABL1_HUMAN | P00519 from UniProtKB/Swiss-Prot  Length:1130

    Alignment length:267
                                   243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
           ABL1_HUMAN   234 KWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES 500
               SCOP domains d2hz4a_ A: Abel     sone tyrosine kinase (abl)                                                                                                                                                                                                                              SCOP domains
               CATH domains 2hz4A01 A:234-3     17 Phosphorylase Kinase; domain 1                               2hz4A02 A:318-500 Transferase(Phosphotransferase) domain 1                                                                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeee.-----..eeeeee.hhheeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeeee....eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.hhh.eee......ee.....ee.......hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh............hhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------R-----------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP      ---------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:234-274 (gaps)          Exon 1.6  PDB: A:275-303     ----------------------------------------------------------Exon 1.8  PDB: A:362-424 UniProt: 362-424                      --------------------------------------------------Exon 1.10  PDB: A:475-500  Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.7  PDB: A:303-362 UniProt: 303-362                   -------------------------------------------------------------Exon 1.9  PDB: A:424-475 UniProt: 424-475           ------------------------- Transcript 1 (2)
                 2HZ4 A 234 KWEMERTDITMKHKL-----GEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES 500
                                   243    |    -|      263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
                                        248   254                                                                                                                                                                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:261
 aligned with ABL1_HUMAN | P00519 from UniProtKB/Swiss-Prot  Length:1130

    Alignment length:266
                                   242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492      
           ABL1_HUMAN   233 DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQ 498
               SCOP domains d2hz4b_ B: Abels     one tyrosine kinase (abl)                                                                                                                                                                                                                             SCOP domains
               CATH domains 2hz4B01 B:233-31     7 Phosphorylase Kinase; domain 1                                2hz4B02 B:318-498 Transferase(Phosphotransferase) domain 1                                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhh.eeeeee.-----..eeeeee.hhheeeeeee......hhhhhhhhhhhhhh........eeeee......eeeee....eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.hhh.eee......ee.....ee............hhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------R-----------------------------------------------------------------------------------------T----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------PROTEIN_KINASE_ATP      ---------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: B:233-274 (gaps)           Exon 1.6  PDB: B:275-303     ----------------------------------------------------------Exon 1.8  PDB: B:362-424 UniProt: 362-424                      --------------------------------------------------Exon 1.10  PDB: B:475-49 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------Exon 1.7  PDB: B:303-362 UniProt: 303-362                   -------------------------------------------------------------Exon 1.9  PDB: B:424-475 UniProt: 424-475           ----------------------- Transcript 1 (2)
                 2HZ4 B 233 DKWEMERTDITMKHKL-----GEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQ 498
                                   242     |   - |     262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492      
                                         248   254                                                                                                                                                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:259
 aligned with ABL1_HUMAN | P00519 from UniProtKB/Swiss-Prot  Length:1130

    Alignment length:267
                                   243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
           ABL1_HUMAN   234 KWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES 500
               SCOP domains d2hz4c_ C: Abel     sone tyrosi  ne kinas e (abl)                                                                                                                                                                                                                           SCOP domains
               CATH domains 2hz4C01 C:234-3     17 Phosphor  ylase Ki nase; domain 1                            2hz4C02 C:318-500 Transferase(Phosphotransferase) domain 1                                                                                                                              CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhh.eeeeee.-----..eeeeee...--.eeeee..-...hhhhhhhhhhhhh.........eeeee......eeeee....eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.hhh.eee......ee.....ee............hhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------R-----------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------PROTEIN_KINASE_ATP      ---------------------------------------------------------------------------------------PROTEIN_KINAS--------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: C:234-274 (gaps)          Exon 1.6  PDB: C:276-303     ----------------------------------------------------------Exon 1.8  PDB: C:362-424 UniProt: 362-424                      --------------------------------------------------Exon 1.10  PDB: C:475-500  Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.7  PDB: C:303-362 UniProt: 303-362                   -------------------------------------------------------------Exon 1.9  PDB: C:424-475 UniProt: 424-475           ------------------------- Transcript 1 (2)
                 2HZ4 C 234 KWEMERTDITMKHKL-----GEVYEGVWKKY--TVAVKTLK-DTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES 500
                                   243    |    -|      263|  |   273| |    283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
                                        248   254       264  |    274 |                                                                                                                                                                                                                                
                                                           267      276                                                                                                                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'