Select entry :   
(by PDB/NDB code)           

 Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:102
 aligned with NUCL_HUMAN | P19338 from UniProtKB/Swiss-Prot  Length:710

    Alignment length:139
                                   529       539       549       559       569       579       589       599       609       619       629       639       649         
           NUCL_HUMAN   520 GKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGG 658
               SCOP domains d2f                                    c8a_  A: automated matches                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...------------------------------------....-..........eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RRM  PDB: - UniProt: 486-560             -----------RRM  PDB: A:16-91 UniProt: 572-647                                          ----------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2FC8 A   1 GSS------------------------------------GSSG-PNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG 102
                              |      -         -         -         4  | |   13        23        33        43        53        63        73        83        93         
                              3                                    4  7 8                                                                                              

Chain A from PDB  Type:PROTEIN  Length:102
 aligned with Q9BQ02_HUMAN | Q9BQ02 from UniProtKB/TrEMBL  Length:482

    Alignment length:139
                                   301       311       321       331       341       351       361       371       381       391       401       411       421         
         Q9BQ02_HUMAN   292 GKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGG 430
               SCOP domains d2f                                    c8a_  A: automated matches                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...------------------------------------....-..........eeee.......hhhhhhh.....eeeee..........eeeee...hhhhhhhhhhh...ee..ee.eeee.............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2FC8 A   1 GSS------------------------------------GSSG-PNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGSGPSSG 102
                              |      -         -         -         4  | |   13        23        33        43        53        63        73        83        93         
                              3                                    4  7 8                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'